Weight | 1 lbs |
---|---|
Dimensions | 9 × 5 × 2 in |
host | mouse |
isotype | IgG2b |
clonality | monoclonal |
concentration | 1 mg/mL |
applications | ELISA, ICC/IF, WB |
available sizes | 100 µg |
mouse anti-MBP monoclonal antibody (F-6) 9051
$408.00
Antibody summary
- Mouse monoclonal to MBP
- Suitable for: WB,ICC/IF,ELISA
- Reacts with: tagged fusion proteins
- Isotype: IgG1
- 100 µg
mouse anti-MBP monoclonal antibody (F-6) 9051
antibody |
---|
Database link: P0AEX9 Sequence - MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIK VTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTW DAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEP YFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAE AAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKE LAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIP QMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK |
Tested applications WB,ICC/IF,ELISA |
Recommended dilutions WB: 1:1000-3000 ICC/IF: 1:500-2000 For best results with other assays (e.g.: Dot, ELISA, IP, etc), please determine optimal working dilution by titration test. |
Immunogen Purified recombinant MBP fusion protein expressed in?E. Coli |
Size and concentration 100µg and 1 mg/mL |
Form liquid |
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles. |
Storage buffer PBS, pH 7.2, 0.05% NaN3 |
Purity affinity purified |
Clonality monoclonal |
Isotype IgG1 |
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
Isotype control Mouse monocolonal IgG1 - Isotype Control |
target relevance |
---|
MBP can be used as a tag to aid in the expression and folding of fusion proteins. This antibody can be used to confirm expression and quantify the MBP tagged recombinant proteins in Western blotting and for their purification/copurification. When imaging in situ, MBP tagged proteins can be identified by this antibody when used in conjunction with a suitable secondary antibody. Click for more on: epitope tags and MBP |
Biotechnology Maltose-binding protein (MBP) has emerged as a highly effective and widely used fusion protein in biotechnology and recombinant protein expression. MBP is a stable, soluble, and well-folded protein that exhibits a strong affinity for maltose, making it an excellent tool for enhancing the expression and solubility of target proteins. In the context of fusion proteins, MBP is often genetically linked to a target protein of interest, allowing for simultaneous production of both proteins. The presence of MBP aids in proper folding and stability of the fused target protein, preventing aggregation and proteolytic degradation. Additionally, MBP can facilitate the purification of the fusion protein through affinity chromatography, where the fusion protein can be selectively eluted using maltose. This purification process greatly simplifies and expedites protein purification, ensuring high yields of correctly folded and biologically active target protein. Due to its versatile applications and benefits, MBP fusion proteins have become indispensable tools in structural biology, enzymology, and a wide range of biotechnological applications. |
Publications
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from PubMed database provided by The United States National Library of Medicine at the National Institutes of Health.pmid | title | authors | citation |
---|
Protocols
relevant to this product |
---|
Western blot ICC |
Documents
# | |||
---|---|---|---|
No results found |
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.