| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG2b |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ELISA, ICC/IF, WB |
| available sizes | 100 µg |
mouse anti-MBP monoclonal antibody (F-6) 9051
$408.00
Antibody summary
- Mouse monoclonal to MBP
- Suitable for: WB,ICC/IF,ELISA
- Reacts with: tagged fusion proteins
- Isotype: IgG1
- 100 µg
mouse anti-MBP monoclonal antibody (F-6) 9051
| antibody |
|---|
| Database link: P0AEX9 Sequence - MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIK VTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTW DAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEP YFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAE AAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKE LAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIP QMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK |
| Tested applications WB,ICC/IF,ELISA |
| Recommended dilutions WB: 1:1000-3000 ICC/IF: 1:500-2000 For best results with other assays (e.g.: Dot, ELISA, IP, etc), please determine optimal working dilution by titration test. |
| Immunogen Purified recombinant MBP fusion protein expressed in?E. Coli |
| Size and concentration 100µg and 1 mg/mL |
| Form liquid |
| Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles. |
| Storage buffer PBS, pH 7.2, 0.05% NaN3 |
| Purity affinity purified |
| Clonality monoclonal |
| Isotype IgG1 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG1 - Isotype Control |
| target relevance |
|---|
| Discosoma sp. RFP Red fluorescent protein drFP583 |
| Protein names Red fluorescent protein drFP583 |
| Protein family Belongs to the GFP family |
| Function Thought to play a role in photoprotection of the coral's resident symbiont microalgae's photosystems from photoinhibition caused by high light levels found near the surface of coral reefs. In deeper water, the fluorescence may be to convert blue light into longer wavelengths more suitable for use in photosynthesis by the microalgal symbionts |
| Structure Homotetramer |
| Post-translational modification Contains a chromophore consisting of modified amino acid residues. The chromophore is formed by autocatalytic backbone condensation between Xaa-N and Gly-(N+2), oxidation of Tyr-(N+1) to didehydrotyrosine, and formation of a double bond to the alpha-amino nitrogen of residue Xaa-N. Maturation of the chromophore requires nothing other than molecular oxygen |
| Keywords 3D-structure, Chromophore, Luminescence, Photoprotein |
| Sequence MRSSKNVIKEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEGHNTVKLKVTKGGPLPFAWDI LSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGCFIY KVKFIGVNFPSDGPVMQKKTMGWEASTERLYPRDGVLKGEIHKALKLKDGGHYLVEFKSI YMAKKPVQLPGYYYVDSKLDITSHNEDYTIVEQYERTEGRHHLFL |
| UniProt accession: Q9U6Y8 |
Data
 |
 |
 |
 |
 |
 |
 |
 |
 |
 |
FAQ & Publications
Frequently Asked Questions
What applications is the mouse anti-MBP monoclonal antibody (F-6) 9051 validated for, and what are the recommended dilution ranges?
This antibody is validated for Western blotting (WB), immunocytochemistry/immunofluorescence (ICC/IF), and ELISA. The recommended dilution ranges are 1:1000-3000 for WB and 1:500-2000 for ICC/IF. For other assays such as Dot, ELISA, or immunoprecipitation (IP), optimal working dilutions should be determined by titration.
How should the mouse anti-MBP monoclonal antibody (F-6) 9051 be stored to maintain its stability?
For short-term storage, keep the antibody at 2-8°C. For long-term storage, store it at -20°C and avoid repeated freeze/thaw cycles to preserve antibody integrity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.