mouse anti-GST monoclonal antibody (GST.B6) 8446

Price range: $100.00 through $2,600.00

Antibody summary

Mouse monoclonal to GST
Suitable for: WB,ICC/IF,ELISA
Reacts with: tagged fusion proteins
Isotype: IgG2a
100 µg, 25 µg, 1 mg

available sizes

Clear

SKU: 8446parent Categories: antibody, epitope tag Tag: GST

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2a
clonality	monoclonal
concentration	1 mg/mL
applications	ELISA, ICC/IF, WB
reactivity	tagged fusion proteins
available sizes	1 mg, 100 µg, 25 µg

mouse anti-GST monoclonal antibody (GST.B6) 8446

antibody
Database link: GST tag P08515 Sequence- MSPILGYWKIKGLVQPTRLLLEYLEEKYEE HLYERDEGDKWRNKKFELGLEFPNLPYYID GDVKLTQSMAIIRYIADKHNMLGGCPKERA EISMLEGAVLDIRYGVSRIAYSKDFETLKV DFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFK KRIEAIPQIDKYLKSSKYIAWPLQGWQATF GGGDHPPKSD
Tested applications WB,ICC/IF,ELISA
Recommended dilutions WB: 1:1000-3000 ICC/IF: 1:500-2000
Immunogen Highly purified Glutathione-S-transferase (GST) from Schistosoma japonicum
Size and concentration 25, 100, 1000µg and 1 mg/mL
Form liquid
Storage Instructions -20°C for 2 years or more. Centrifuge after first thaw to maximize product recovery. Aliquot to avoid repeated freeze-thaw cycles. Store aliquots at 4°C for several days to weeks.
Storage buffer PBS, pH 7.2, 0.05% NaN₃
Purity affinity purified
Clonality monoclonal
Isotype IgG2a
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monocolonal IgG2a - Isotype Control

target relevance
GST
Protein names Glutathione S-transferase tag
Alternative names GST tag, GST fusion tag, Schistosoma japonicum GST
Function The GST tag is fused to recombinant proteins to facilitate purification, detection, immobilization, and analysis of protein-protein interactions through high-affinity binding to glutathione.
Structure GST is a soluble enzyme of approximately 26 kDa that forms a stable folded protein domain when fused to target proteins.
Description The GST tag is a recombinant protein fusion tag derived from Schistosoma japonicum glutathione S-transferase. It is widely used for affinity purification, protein detection, pull-down assays, and studies of protein-protein interactions.
Related entities relationship: binds_to; entity: Glutathione
Keywords Fusion tag, Affinity purification, Pull-down assay, Protein-protein interaction, Recombinant protein
Structure The GST tag is a 26 kDa protein derived from Schistosoma japonicum glutathione S-transferase. Unlike small epitope tags such as FLAG or HA, GST is a folded protein domain.
Function GST functions as an affinity tag that enables purification, detection, and immobilization of recombinant fusion proteins through binding to glutathione.
Purification GST-tagged proteins are typically purified using glutathione agarose or glutathione magnetic beads under native conditions.
Applications GST fusion proteins are widely used in western blotting, ELISA, affinity purification, pull-down assays, protein interaction studies, and recombinant protein production.
Research relevance GST is one of the most widely used recombinant fusion tags and is particularly valuable for protein purification and protein-protein interaction experiments.

Data

1:5,000 (0.2µg/mL) Ab dilution probed against BL-21 bacteria lysate expressing the GST protein.

FAQ & Publications

Frequently Asked Questions

What applications has the mouse anti-GST monoclonal antibody (GST.B6) been validated for?

This antibody has been tested and validated for use in Western blotting (WB), immunocytochemistry/immunofluorescence (ICC/IF), and ELISA applications.

What is the recommended storage condition for maintaining the stability of this antibody?

The antibody should be stored at -20°C for up to two years or more. After the first thaw, centrifuge to maximize product recovery and aliquot to avoid repeated freeze-thaw cycles. Aliquots can be kept at 4°C for several days to weeks.

Which species does the mouse anti-GST monoclonal antibody specifically react with?

This antibody specifically reacts with GST-tagged fusion proteins, irrespective of the species of the fusion protein, as it targets the GST tag derived from Schistosoma japonicum.

What is the host species and clonality of this anti-GST antibody?

The antibody is a mouse monoclonal with an IgG2a isotype.

What is the concentration and available sizes for this antibody product?

The antibody is supplied at a concentration of 1 mg/mL and is available in sizes of 25 µg, 100 µg, and 1 mg.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.