Skip to content

mouse anti-MBP monoclonal antibody (MBP61R) 6906

$100.00$2,600.00

Antibody summary

  • Mouse monoclonal to MBP
  • Suitable for: WB,ICC/IF,ELISA
  • Reacts with: tagged fusion proteins
  • Isotype: IgG2b
  • 100 µg, 25 µg, 1 mg
Calculate shipping price

Please fill in the fields below with the shipping destination details in order to calculate the shipping cost.

SKU: 6906parent Categories: , Tags: , ,
Weight1 lbs
Dimensions9 × 5 × 2 in
host

mouse

isotype

IgG2b

clonality

monoclonal

concentration

1 mg/mL

applications

ELISA, ICC/IF, WB

available sizes

1 mg, 100 µg, 25 µg

antibody
Database link:
P0AEX9
Sequence - MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIK VTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTW DAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEP YFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAE AAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKE LAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIP QMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK
Tested applications
WB,ICC/IF,ELISA
Recommended dilutions
WB: 1:1000-3000 ICC/IF: 1:500-2000 For best results with other assays (e.g.: Dot, ELISA, IP, etc), please determine optimal working dilution by titration test.
Immunogen
Purified recombinant MBP fusion protein expressed in E. Coli
Size and concentration
25, 100, 1000µg and 1 mg/mL
Form
liquid
Storage buffer
PBS, pH 7.2, 0.05% NaN3
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG2b
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monocolonal IgG2b - Isotype Control
target relevance
MBP can be used as a tag to aid in the expression and folding of fusion proteins. This antibody can be used to confirm expression and quantify the MBP tagged recombinant proteins in Western blotting and for their purification/copurification. When imaging in situ, MBP tagged proteins can be identified by this antibody when used in conjunction with a suitable secondary antibody.

Click for more on: epitope tags and MBP
Biotechnology
Maltose-binding protein (MBP) has emerged as a highly effective and widely used fusion protein in biotechnology and recombinant protein expression. MBP is a stable, soluble, and well-folded protein that exhibits a strong affinity for maltose, making it an excellent tool for enhancing the expression and solubility of target proteins. In the context of fusion proteins, MBP is often genetically linked to a target protein of interest, allowing for simultaneous production of both proteins. The presence of MBP aids in proper folding and stability of the fused target protein, preventing aggregation and proteolytic degradation. Additionally, MBP can facilitate the purification of the fusion protein through affinity chromatography, where the fusion protein can be selectively eluted using maltose. This purification process greatly simplifies and expedites protein purification, ensuring high yields of correctly folded and biologically active target protein. Due to its versatile applications and benefits, MBP fusion proteins have become indispensable tools in structural biology, enzymology, and a wide range of biotechnological applications.

Data

WB-image-mouse-anti-MBP-monoclonal-antibody-MBP61R-6906
1:2000 (0.5µg/mL) Ab dilution probed against purified MBP: 50ng (1), 24ng (2), 12ng (3), 6ng (4), and 3ng (5).

Publications

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from PubMed database provided by The United States National Library of Medicine at the National Institutes of Health.

pmidtitleauthorscitation

Protocols

relevant to this product
Western blot
ICC

Documents

#
No results found

Reviews

There are no reviews yet.

Be the first to review “mouse anti-MBP monoclonal antibody (MBP61R) 6906”