chicken anti-Beta Galactosidase polyclonal antibody 1779

Price range: $100.00 through $2,600.00

Antibody summary

Chicken polyclonal to βGal
Suitable for: WB, ICC/IF, IHC
Reacts with: tagged fusion proteins
Isotype: IgY
100 µg, 25 µg, 1 mg

available sizes

Clear

SKU: 1779parent Categories: antibody, epitope tag Tag: bGal

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	chicken
isotype	IgY
clonality	polyclonal
concentration	1 mg/mL
applications	ICC/IF, IHC, WB
available sizes	1 mg, 100 µg, 25 µg

chicken anti-Beta Galactosidase polyclonal antibody 1779

antibody
Database link: P00722
Tested applications WB,ICC/IF,IHC
Recommended dilutions WB: 1:1000-3000 ICC/IF: 1:500-2000 For best results with other assays (e.g.: Dot, ELISA, IP, etc), please determine optimal working dilution by titration test.
Immunogen Chickens were immunized with highly purified beta-galactosidase from Escherichia col
Size and concentration 100µg and 1 mg/mL
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Storage buffer PBS, pH 7.2, 0.09% NaN₃
Purity affinity purified
Clonality polyclonal
Isotype IgY
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Chicken polyclonal - Isotype Control

target relevance
Escherichia coli (strain K12) LACZ Beta-galactosidase
Protein names Beta-galactosidase
Alternative names Lactase
Gene names lacZ
Protein family Belongs to the glycosyl hydrolase 2 family
Catalytic activity Hydrolysis of terminal non-reducing beta-D-galactose residues in beta-D-galactosides.
Structure Homotetramer
Keywords 3D-structure, Direct protein sequencing, Glycosidase, Hydrolase, Magnesium, Manganese, Metal-binding, Reference proteome, Sodium
Sequence MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR FAWFPAPEAVPESWLECDLPEADTVVVPSNWQMHGYDAPIYTNVTYPITVNPPFVPTENP TGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYGQDSRLPSEFDLSAFLRA GENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQISDFHVATRFNDDFSRAV LEAEVQMCGELRDYLRVTVSLWQGETQVASGTAPFGGEIIDERGGYADRVTLRLNVENPK LWSAEIPNLYRAVVELHTADGTLIEAEACDVGFREVRIENGLLLLNGKPLLIRGVNRHEH HPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEANIETHG MVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVIIWSLGNESGHGANHDALYRWIKSVD PSRPVQYEGGGADTTATDIICPMYARVDEDQPFPAVPKWSIKKWLSLPGETRPLILCEYA HAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSLIKYDENGNPWSAYGGDFGDTPNDR QFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGQTIEVTSEYLFRHSDNELLHWMVALD GKPLASGEVPLDVAPQGKQLIELPELPQPESAGQLWLTVRVVQPNATAWSEAGHISAWQQ WRLAENLSVTLPAASHAIPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTP LRDQFTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTA HAWQHQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPHPARIGLNCQLAQVAERVNWLG LGPQENYPDRLTAACFDRWDLPLSDMYTPYVFPSENGLRCGTRELNYGPHQWRGDFQFNI SRYSQQQLMETSHRHLLHAEEGTWLNIDGFHMGIGGDDSWSPSVSAEFQLSAGRYHYQLV WCQK
UniProt accession: P00722

Data

https://benchmarkantibodies.com/wp-content/uploads/2024/04/1779_1.jpg

Immunofluorescence cell staining- chicken anti-Beta Galactosidase polyclonal antibody 1779 Immunofluorescent analysis of 4% paraformaldehyde (PFA) - fixed, permeabilized with 0.1% triton X-100 CHO cells transfected with beta galactosidase constructs (CHO-BGAL) labeling beta galactosidase with antibody #1779 at 1/1000 dilution (1µg/mL), followed by Donkey Anti-chicken IgY, Alexa 594 conjugate at 1/1000 (1µg/mL) (red). Nucleus was counterstained with DAPI (blue). Also shown staining in parental cell line.

https://benchmarkantibodies.com/wp-content/uploads/2024/04/1779_3.jpg

IHC cell staining- chicken anti-Beta Galactosidase polyclonal antibody 1779

FAQ & Publications

Frequently Asked Questions

What applications has the chicken anti-Beta Galactosidase polyclonal antibody 1779 been validated for?

This antibody has been tested and validated for Western blot (WB), immunocytochemistry/immunofluorescence (ICC/IF), and immunohistochemistry (IHC) applications.

How should the chicken anti-Beta Galactosidase polyclonal antibody 1779 be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C and freeze/thaw cycles should be avoided to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.