mouse anti-GFP monoclonal antibody (GF28R) 7414

Price range: $100.00 through $2,600.00

Antibody summary

Mouse monoclonal to GFP
Suitable for: WB,ICC/IF,ELISA
Reacts with: tagged fusion proteins
Isotype: IgG2b
100 µg, 25 µg, 1 mg

available sizes

Clear

SKU: 7414parent Categories: antibody, epitope tag Tag: GFP

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b
clonality	monoclonal
concentration	1 mg/mL
applications	ELISA, ICC/IF, WB
reactivity	tagged fusion proteins
available sizes	1 mg, 100 µg, 25 µg

mouse anti-GFP monoclonal antibody (GF28R) 7414

antibody
Database link: P42212
Tested applications WB,ICC/IF,ELISA
Recommended dilutions WB: 1:1000-3000 ICC/IF: 1:500-2000 For best results with other assays (e.g.: Dot, ELISA, IP, etc), please determine optimal working dilution by titration test.
Immunogen GFP from the jellyfish?Aequorea victoria?N-terminal peptide-KLH conjugates.
Size and concentration 25, 100, 1000µg and 1 mg/mL
Form liquid
Storage Instructions -20°C for 2 years or more. °Centrifuge after first thaw to maximize product recovery. Aliquot to avoid repeated freeze-thaw cycles. Store aliquots at 4°C for several days to weeks.
Storage buffer PBS, pH 7.2, 0.05% NaN₃
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monocolonal IgG2b - Isotype Control

target relevance
Aequorea victoria GFP Green fluorescent protein
Protein names Green fluorescent protein
Gene names GFP
Protein family Belongs to the GFP family
Function Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca(2+)-activated photoprotein aequorin
Structure Monomer
Post-translational modification Contains a chromophore consisting of modified amino acid residues. The chromophore is formed by autocatalytic backbone condensation between Ser-65 and Gly-67, and oxidation of Tyr-66 to didehydrotyrosine. Maturation of the chromophore requires nothing other than molecular oxygen
Keywords 3D-structure, Chromophore, Direct protein sequencing, Luminescence, Photoprotein
Sequence MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL VTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLV NRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLAD HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
UniProt accession: P42212

Data

1:1,000 (1µg/mL) Ab dilution probed against HEK293 cells transfected with GFP-tagged protein vector: untransfected control (1), 1µg (2) and 10µg (3) of cell lysates used.

FAQ & Publications

Frequently Asked Questions

What applications has the mouse anti-GFP monoclonal antibody (GF28R) 7414 been validated for?

This antibody has been tested and validated for Western Blot (WB), Immunocytochemistry/Immunofluorescence (ICC/IF), and ELISA applications.

How should the mouse anti-GFP monoclonal antibody (GF28R) be stored to maintain stability?

The antibody should be stored at -20°C for long-term stability of 2 years or more. After first thawing, centrifuge to maximize product recovery, aliquot to avoid repeated freeze-thaw cycles, and keep aliquots at 4°C for several days to weeks.

What is the recommended dilution range for using this antibody in Western blot and immunofluorescence assays?

For Western blot, the recommended dilution is between 1:1000 and 1:3000. For immunocytochemistry/immunofluorescence, the suggested dilution range is 1:500 to 1:2000. Optimal dilutions for other assays should be determined by titration.

Publications

pmid	title	authors	citation
36353537	Parthenolide and arsenic trioxide co-trigger autophagy-accompanied apoptosis in hepatocellular carcinoma cells.	Juan Yi, Xia Gong, Xiao-Yang Yin, Li Wang, Jin-Xia Hou, Jing Chen, Bei Xie, Gang Chen, Li-Na Wang, Xiao-Yuan Wang, Da-Chun Wang, Hu-Lai Wei	Front Oncol 12:988528
36052744	Herbivore-induced Ca(2+) signals trigger a jasmonate burst by activating ERF16-mediated expression in tomato.	Chaoyi Hu, Shaofang Wu, Jiajia Li, Han Dong, Changan Zhu, Ting Sun, Zhangjian Hu, Christine H Foyer, Jingquan Yu	New Phytol 236:1796-1808
35880301	ECM dimensionality tunes actin tension to modulate endoplasmic reticulum function and spheroid phenotypes of mammary epithelial cells.	FuiBoon Kai, Guanqing Ou, Richard W Tourdot, Connor Stashko, Guido Gaietta, Mark F Swift, Niels Volkmann, Alexandra F Long, Yulong Han, Hector H Huang, Jason J Northey, Andrew M Leidal, Virgile Viasnoff, David M Bryant, Wei Guo, Arun P Wiita, Ming Guo, Sophie Dumont, Dorit Hanein, Ravi Radhakrishnan, Valerie M Weaver	EMBO J 41:e109205
35880301	ECM dimensionality tunes actin tension to modulate endoplasmic reticulum function and spheroid phenotypes of mammary epithelial cells.	FuiBoon Kai, Guanqing Ou, Richard W Tourdot, Connor Stashko, Guido Gaietta, Mark F Swift, Niels Volkmann, Alexandra F Long, Yulong Han, Hector H Huang, Jason J Northey, Andrew M Leidal, Virgile Viasnoff, David M Bryant, Wei Guo, Arun P Wiita, Ming Guo, Sophie Dumont, Dorit Hanein, Ravi Radhakrishnan, Valerie M Weaver	EMBO J 41:e109205
35851616	ADAR1 downregulation by autophagy drives senescence independently of RNA editing by enhancing p16(INK4a) levels.	Xue Hao, Yusuke Shiromoto, Masayuki Sakurai, Martina Towers, Qiang Zhang, Shuai Wu, Aaron Havas, Lu Wang, Shelley Berger, Peter D Adams, Bin Tian, Kazuko Nishikura, Andrew V Kossenkov, Pingyu Liu, Rugang Zhang	Nat Cell Biol 24:1202-1210

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.