rabbit anti-GFP polyclonal antibody 1778

Price range: $100.00 through $2,600.00

Antibody summary

Rabbit polyclonal to GFP
Suitable for: WB, ICC/IF
Reacts with: tagged fusion proteins
Isotype: IgG
100 µg, 25 µg, 1 mg

available sizes

Clear

SKU: 1778parent Categories: antibody, epitope tag Tag: GFP

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	rabbit
isotype	IgG
clonality	polyclonal
concentration	1 mg/mL
applications	ICC/IF, WB
reactivity	tagged fusion proteins
available sizes	1 mg, 100 µg, 25 µg

rabbit anti-GFP polyclonal antibody 1778

antibody
Database link: P42212
Tested applications WB,ICC/IF,IHC
Recommended dilutions WB: 1:1000-3000 ICC/IF: 1:500-2000 For best results with other assays (e.g.: Dot, ELISA, IP, etc), please determine optimal working dilution by titration test.
Immunogen Recombinant GFP expressed in and purified from E. coli
Size and concentration 100µg and 1 mg/mL
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Storage buffer PBS, pH 7.2, 0.09% NaN₃
Purity affinity purified
Clonality polyclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Aequorea victoria GFP Green fluorescent protein
Protein names Green fluorescent protein
Gene names GFP
Protein family Belongs to the GFP family
Function Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca(2+)-activated photoprotein aequorin
Structure Monomer
Post-translational modification Contains a chromophore consisting of modified amino acid residues. The chromophore is formed by autocatalytic backbone condensation between Ser-65 and Gly-67, and oxidation of Tyr-66 to didehydrotyrosine. Maturation of the chromophore requires nothing other than molecular oxygen
Keywords 3D-structure, Chromophore, Direct protein sequencing, Luminescence, Photoprotein
Sequence MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL VTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLV NRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLAD HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
UniProt accession: P42212

Data

https://benchmarkantibodies.com/wp-content/uploads/2024/04/1778_1.jpg

https://benchmarkantibodies.com/wp-content/uploads/2024/04/1778_2.jpg

https://benchmarkantibodies.com/wp-content/uploads/2024/04/1778_3.jpg

FAQ & Publications

Frequently Asked Questions

What applications has the rabbit anti-GFP polyclonal antibody 1778 been validated for?

This antibody has been tested and validated for use in Western blotting (WB), immunocytochemistry/immunofluorescence (ICC/IF), and immunohistochemistry (IHC). Recommended dilutions are 1:1000-3000 for WB and 1:500-2000 for ICC/IF.

How should the rabbit anti-GFP polyclonal antibody 1778 be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C. Avoid repeated freeze/thaw cycles to preserve antibody integrity.

What is the immunogen used to generate this rabbit anti-GFP polyclonal antibody?

The immunogen is recombinant GFP expressed in and purified from Escherichia coli.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.