rabbit anti-GFP polyclonal antibody 9005

$409.00

Antibody summary

Rabbit polyclonal to GFP
Suitable for: WB, ICC/IF
Reacts with: tagged fusion proteins
Isotype: IgG
100 µg

SKU: 9005 Categories: antibody, epitope tag Tag: GFP

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	rabbit
isotype	IgG
clonality	polyclonal
concentration	1 mg/mL
applications	ICC/IF, WB
available sizes	100 µg

rabbit anti-GFP polyclonal antibody 9005

antibody
Database link: P42212
Tested applications WB,ICC/IF
Recommended dilutions WB: 1:1000-5000 IF/ICC 1:2000-5000
Immunogen Recombinant AcGFP expressed in and purified from E. coli
Size and concentration 100µg and 1 mg/mL
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Storage buffer PBS, 50% glycerol, 0.04% NaN₃
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit monoclonal - Isotype Control

target relevance
Aequorea victoria GFP Green fluorescent protein
Protein names Green fluorescent protein
Gene names GFP
Protein family Belongs to the GFP family
Function Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca(2+)-activated photoprotein aequorin
Structure Monomer
Post-translational modification Contains a chromophore consisting of modified amino acid residues. The chromophore is formed by autocatalytic backbone condensation between Ser-65 and Gly-67, and oxidation of Tyr-66 to didehydrotyrosine. Maturation of the chromophore requires nothing other than molecular oxygen
Keywords 3D-structure, Chromophore, Direct protein sequencing, Luminescence, Photoprotein
Sequence MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL VTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLV NRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLAD HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
UniProt accession: P42212

Data

benchmarkantibodies.com/wp-content/uploads/2024/03/9005_1.jpg

Whole cell lysate (5 µg) from 293T cells transfected with EGFP, YP, CFP, AcGFP, or BFP. Antibody: Rabbit anti-GFP recombinant monoclonal antibody 9005 used at 1:1000. Secondary: HRP-conjugated goat anti-rabbit IgG. Detection: Chemiluminescence with an exposure time of 3 seconds. Lower Panel: Rabbit anti-Actin recombinant monoclonal antibody.

benchmarkantibodies.com/wp-content/uploads/2024/03/9005_2.jpg

Whole cell lysate (10 µg) from HEK293T cells transfected with EGFP-KAP1, KAP1-EGFP, or untransfected. Antibody: Rabbit anti-GFP recombinant monoclonal antibody used at 1:1000. Secondary: HRP-conjugated goat anti-rabbit IgG. Detection: Chemiluminescence with an exposure time of 10 seconds. Lower Panel: Rabbit anti-Actin recombinant monoclonal antibody.

benchmarkantibodies.com/wp-content/uploads/2024/03/9005_3.jpg

Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from 293-F cells transfected with EGFP-KAP1. Antibodies: Rabbit anti-GFP recombinant monoclonal antibody 9005 used for IP at 20 µl/mg lysate. GFP was also immunoprecipitated by a second antibody against a different epitope of GFP. For blotting immunoprecipitated GFP, 9005 was used at 1:1000. Detection: Chemiluminescence with an exposure time of 10 seconds.

benchmarkantibodies.com/wp-content/uploads/2024/03/9005_4.jpg

FFPE section of HEK293 cells expressing a GFP nuclear protein (left) and untransfected HEK293 cells (right). Antibody: Rabbit anti-GFP recombinant monoclonal antibody 9005. Secondary: HRP-conjugated goat anti-rabbit IgG.

FAQ & Publications

Frequently Asked Questions

What applications is the rabbit anti-GFP polyclonal antibody 9005 validated for?

This antibody is validated for use in Western blotting (WB) and immunocytochemistry/immunofluorescence (ICC/IF) applications.

How should the rabbit anti-GFP polyclonal antibody 9005 be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C, avoiding repeated freeze-thaw cycles to maintain antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.