mouse anti-RFP monoclonal antibody (RF5R) 1018

Price range: $100.00 through $2,600.00

Antibody summary

Mouse monoclonal to RFP
Suitable for: WB,ICC/IF,ELISA
Reacts with: tagged fusion proteins
Isotype: IgG1
100 µg

available sizes

Clear

SKU: 1018parent Categories: antibody, epitope tag Tag: RFP

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	1 mg/mL
applications	ELISA, ICC/IF, WB
reactivity	tagged fusion proteins
available sizes	1 mg, 100 µg, 25 µg

mouse anti-RFP monoclonal antibody (RF5R) 1018

antibody
Database link: Q9U6Y8
Tested applications WB,ICC/IF,ELISA
Recommended dilutions WB: 1:1000-3000 ICC/IF: 1:500-2000 For best results with other assays (e.g.: Dot, ELISA, IP, etc), please determine optimal working dilution by titration test.
Immunogen RFP from the?Discosoma sp.?(sea anemone) N-terminal peptide-KLH conjugates
Size and concentration 25, 100, 1000µg and 1 mg/mL
Form liquid
Storage Instructions -20°C for 2 years or more. Centrifuge after first thaw to maximize product recovery. Aliquot to avoid repeated freeze-thaw cycles. Store aliquots at 4°C for several days to weeks.
Storage buffer PBS, pH 7.2, 0.05% NaN₃
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monocolonal IgG1 - Isotype Control

target relevance
Discosoma sp. RFP Red fluorescent protein drFP583
Protein names Red fluorescent protein drFP583
Protein family Belongs to the GFP family
Function Thought to play a role in photoprotection of the coral's resident symbiont microalgae's photosystems from photoinhibition caused by high light levels found near the surface of coral reefs. In deeper water, the fluorescence may be to convert blue light into longer wavelengths more suitable for use in photosynthesis by the microalgal symbionts
Structure Homotetramer
Post-translational modification Contains a chromophore consisting of modified amino acid residues. The chromophore is formed by autocatalytic backbone condensation between Xaa-N and Gly-(N+2), oxidation of Tyr-(N+1) to didehydrotyrosine, and formation of a double bond to the alpha-amino nitrogen of residue Xaa-N. Maturation of the chromophore requires nothing other than molecular oxygen
Keywords 3D-structure, Chromophore, Luminescence, Photoprotein
Sequence MRSSKNVIKEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEGHNTVKLKVTKGGPLPFAWDI LSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGCFIY KVKFIGVNFPSDGPVMQKKTMGWEASTERLYPRDGVLKGEIHKALKLKDGGHYLVEFKSI YMAKKPVQLPGYYYVDSKLDITSHNEDYTIVEQYERTEGRHHLFL
UniProt accession: Q9U6Y8

Data

1:1000 (1µg/mL) Ab dilution probed against HEK293 cells transfected with RFP-tagged protein vector; untransfected control (1), transfected with TurboRFP (2), and transfected with dsRed (3).

FAQ & Publications

Frequently Asked Questions

What applications is the mouse anti-RFP monoclonal antibody (RF5R) 1018 validated for, and what are the recommended dilutions?

This antibody is validated for Western blotting (WB), immunocytochemistry/immunofluorescence (ICC/IF), and ELISA. Recommended dilutions are 1:1000-3000 for WB and 1:500-2000 for ICC/IF. For other assays, such as dot blot or immunoprecipitation, optimal dilutions should be determined by titration.

How should the mouse anti-RFP monoclonal antibody (RF5R) 1018 be stored to maintain stability and activity?

The antibody should be stored at -20°C for long-term storage (up to 2 years or more). After the first thaw, centrifuge to maximize product recovery, aliquot to avoid repeated freeze-thaw cycles, and store aliquots at 4°C for several days to weeks. The storage buffer is PBS, pH 7.2, containing 0.05% sodium azide.

Publications

pmid	title	authors	citation
26071555	Visualization of Fra-1/AP-1 activation during LPS-induced inflammatory lung injury using fluorescence optical imaging.	Subbiah Rajasekaran, Chandramohan R Tamatam, Haranatha R Potteti, Venu Raman, Jae-Woo Lee, Michael A Matthay, Dolly Mehta, Narsa M Reddy, Sekhar P Reddy	Am J Physiol Lung Cell Mol Physiol 309:L414-24

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.