chicken anti-GFP polyclonal antibody 1777

Price range: $100.00 through $2,600.00

Antibody summary

Chicken polyclonal to GFP
Suitable for: WB, ICC/IF, IHC
Reacts with: tagged fusion proteins
Isotype: IgY
100 µg, 25 µg, 1 mg

available sizes

Clear

SKU: 1777parent Categories: antibody, epitope tag Tag: GFP

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	chicken
isotype	IgY
clonality	polyclonal
concentration	1 mg/mL
applications	ICC/IF, IHC, WB
available sizes	1 mg, 100 µg, 25 µg

chicken anti-GFP polyclonal antibody 1777

antibody
Database link: P42212
Tested applications WB,ICC/IF,IHC
Recommended dilutions WB: 1:1000-3000 ICC/IF: 1:500-2000 For best results with other assays (e.g.: Dot, ELISA, IP, etc), please determine optimal working dilution by titration test.
Immunogen Recombinant GFP expressed in and purified from E. coli
Size and concentration 100µg and 1 mg/mL
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Storage buffer PBS, pH 7.2, 0.09% NaN₃
Purity affinity purified
Clonality polyclonal
Isotype IgY
Compatible secondaries goat anti-chicken IgY, H&L chain specific, peroxidase conjugated polyclonal antibody 1688 goat anti-chicken IgY, H&L chain specific, biotin conjugated polyclonal antibody 8036 goat anti-chicken IgY, H&L chain specific, FITC conjugated, Conjugated polyclonal antibody 4317 goat anti-chicken IgY, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1708 goat anti-chicken IgY, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1718 goat anti-chicken IgY, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1723
Isotype control Chicken polyclonal - Isotype Control

target relevance
Aequorea victoria GFP Green fluorescent protein
Protein names Green fluorescent protein
Gene names GFP
Protein family Belongs to the GFP family
Function Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca(2+)-activated photoprotein aequorin
Structure Monomer
Post-translational modification Contains a chromophore consisting of modified amino acid residues. The chromophore is formed by autocatalytic backbone condensation between Ser-65 and Gly-67, and oxidation of Tyr-66 to didehydrotyrosine. Maturation of the chromophore requires nothing other than molecular oxygen
Keywords 3D-structure, Chromophore, Direct protein sequencing, Luminescence, Photoprotein
Sequence MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL VTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLV NRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLAD HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
UniProt accession: P42212

Data

https://benchmarkantibodies.com/wp-content/uploads/2024/04/1777_1.jpg

Immunofluorescence cell staining- chicken anti-GFP polyclonal antibody 1777 Immunofluorescent analysis of 4% paraformaldehyde (PFA) - fixed, permeabilized with 0.1% triton X-100 CHO cells transfected with GFP constructs (CHO-GFP) anti-GFP polyclonal antibody 1777 at 1/100 dilution (10µg/mL), followed by Goat Anti-chicken IgY, Alexa 594 conjugate at 1/400 (5µg/mL) (red). The image also shows GFP (green), nucleus counterstained with DAPI (blue). Also shown lack of staining in parental cell line and from secondary only controls.

https://benchmarkantibodies.com/wp-content/uploads/2024/04/1777_3.jpg

Incubation with secondary antibody only.

https://benchmarkantibodies.com/wp-content/uploads/2024/04/1777_4.jpg

Western blot analysis of chicken anti-GFP polyclonal antibody 1777 CHO cells were transfected with pcDNA3-GFP (as CHO-GFP). THE whole cell lysates were loaded at 2µg and 0.2µg per lane them incubated with chicken anti-GFP polyclonal antibody 1777 at 1:10,000 (01.%micro;g/mL) dilution for 1 hour and followed with anti-chicken IgY HRP conjugate at 1:10,000 (0.1µg/mL) at room temperature.

FAQ & Publications

Frequently Asked Questions

What applications is the chicken anti-GFP polyclonal antibody 1777 validated for?

This antibody is validated for use in Western blotting (WB), immunocytochemistry/immunofluorescence (ICC/IF), and immunohistochemistry (IHC). Recommended dilutions are 1:1000-3000 for WB and 1:500-2000 for ICC/IF. For other applications such as Dot blot, ELISA, or immunoprecipitation, it is advised to optimize the working dilution by titration.

How should the chicken anti-GFP polyclonal antibody 1777 be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, store at -20°C and avoid repeated freeze/thaw cycles to preserve antibody integrity. The antibody is supplied in PBS buffer at pH 7.2 containing 0.09% sodium azide as a preservative.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.