| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG2b |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ELISA, ICC/IF, WB |
| reactivity | tagged fusion proteins |
| available sizes | 1 mg, 100 µg, 25 µg |
mouse anti-MBP monoclonal antibody (MBP61R) 6906
Price range: $100.00 through $2,600.00
Antibody summary
- Mouse monoclonal to MBP
- Suitable for: WB,ICC/IF,ELISA
- Reacts with: tagged fusion proteins
- Isotype: IgG2b
- 100 µg, 25 µg, 1 mg
mouse anti-MBP monoclonal antibody (MBP61R) 6906
| antibody |
|---|
| Database link: P0AEX9 Sequence - MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIK VTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTW DAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEP YFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAE AAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKE LAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIP QMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK |
| Tested applications WB,ICC/IF,ELISA |
| Recommended dilutions WB: 1:1000-3000 ICC/IF: 1:500-2000 For best results with other assays (e.g.: Dot, ELISA, IP, etc), please determine optimal working dilution by titration test. |
| Immunogen Purified recombinant MBP fusion protein expressed in?E. Coli |
| Size and concentration 25, 100, 1000µg and 1 mg/mL |
| Form liquid |
| Storage Instructions -20°C for 2 years or more. Centrifuge after first thaw to maximize product recovery. Aliquot to avoid repeated freeze-thaw cycles. Store aliquots at 4°C for several days to weeks. |
| Storage buffer PBS, pH 7.2, 0.05% NaN3 |
| Purity affinity purified |
| Clonality monoclonal |
| Isotype IgG2b |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG2b - Isotype Control |
| target relevance |
|---|
| Discosoma sp. RFP Red fluorescent protein drFP583 |
| Protein names Red fluorescent protein drFP583 |
| Protein family Belongs to the GFP family |
| Function Thought to play a role in photoprotection of the coral's resident symbiont microalgae's photosystems from photoinhibition caused by high light levels found near the surface of coral reefs. In deeper water, the fluorescence may be to convert blue light into longer wavelengths more suitable for use in photosynthesis by the microalgal symbionts |
| Structure Homotetramer |
| Post-translational modification Contains a chromophore consisting of modified amino acid residues. The chromophore is formed by autocatalytic backbone condensation between Xaa-N and Gly-(N+2), oxidation of Tyr-(N+1) to didehydrotyrosine, and formation of a double bond to the alpha-amino nitrogen of residue Xaa-N. Maturation of the chromophore requires nothing other than molecular oxygen |
| Keywords 3D-structure, Chromophore, Luminescence, Photoprotein |
| Sequence MRSSKNVIKEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEGHNTVKLKVTKGGPLPFAWDI LSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGCFIY KVKFIGVNFPSDGPVMQKKTMGWEASTERLYPRDGVLKGEIHKALKLKDGGHYLVEFKSI YMAKKPVQLPGYYYVDSKLDITSHNEDYTIVEQYERTEGRHHLFL |
| UniProt accession: Q9U6Y8 |
Data
![]() |
| 1:2000 (0.5µg/mL) Ab dilution probed against purified MBP: 50ng (1), 24ng (2), 12ng (3), 6ng (4), and 3ng (5). |
FAQ & Publications
Frequently Asked Questions
What applications is the mouse anti-MBP monoclonal antibody (MBP61R) suitable for?
This antibody is suitable for Western blotting (WB), immunocytochemistry/immunofluorescence (ICC/IF), and ELISA applications.
How should the mouse anti-MBP monoclonal antibody be stored to maintain its stability?
Store the antibody at -20°C for up to 2 years or longer. After the first thaw, centrifuge to maximize product recovery, aliquot to avoid repeated freeze-thaw cycles, and keep aliquots at 4°C if using within days to weeks.
What is the host species and clonality of the MBP61R antibody?
The antibody is a mouse monoclonal antibody of the IgG2b isotype.
What is the recommended dilution range for using this antibody in Western blot and ICC/IF?
For Western blotting, the recommended dilution is between 1:1000 and 1:3000. For ICC/IF, a dilution range of 1:500 to 1:2000 is suggested.
What is the immunogen used to generate this mouse anti-MBP monoclonal antibody?
The immunogen is purified recombinant maltose binding protein (MBP) fusion protein expressed in Escherichia coli.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.

















Reviews
There are no reviews yet.