| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ELISA |
| available sizes | 1 mg, 100 µg, 25 µg |
rabbit anti-GST polyclonal antibody 3104
$100.00 – $2,600.00
Antibody summary
- Rabbit polyclonal to GST
- Suitable for: ELISA
- Reacts with: tagged fusion proteins
- Isotype: IgG
- 100 µg, 25 µg, 1 mg
rabbit anti-GST polyclonal antibody 3104
| antibody |
|---|
| Database link: GST tag P08515 Sequence- MSPILGYWKIKGLVQPTRLLLEYLEEKYEE HLYERDEGDKWRNKKFELGLEFPNLPYYID GDVKLTQSMAIIRYIADKHNMLGGCPKERA EISMLEGAVLDIRYGVSRIAYSKDFETLKV DFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFK KRIEAIPQIDKYLKSSKYIAWPLQGWQATF GGGDHPPKSD |
| Tested applications ELISA |
| Recommended dilutions user optimized |
| Immunogen Highly purified Glutathione-S-transferase (GST) from Schistosoma japonicum |
| Size and concentration 25, 100, 1000µg and 1 mg/mL |
| Form liquid |
| Storage Instructions 2-8°C |
| Storage buffer PBS, pH 7.2, 0.09% NaN3 |
| Purity affinity purified |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
Data
 |
| Left rabbit anti-GST polyclonal antibody 3104 labeled with anti-rabbit FITC conjugate (green). Center DAPI (blue). Right merged. |
 |
| The expression of GST was determined by Western blot. CHO cells were transfected with pcDNA3-12 Tags (CHO-12 Tag). The 10µg whole cell lysates of CHO-12 Tag, and CHO were loaded then incubated with rabbit anti-GST polyclonal antibody 3104 at 1:2000 (dilution 0.5 µg/mL) for 1h at room temperature and followed with goat anti-rabbit IgG HRP at 1:5000 dilution (0.2µg/mL) incubation for 1h at room temperature. |
Publications
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from PubMed database provided by The United States National Library of Medicine at the National Institutes of Health.There are 2 publications in our database for this antibody or clone. Here are the latest 5, for more click below.
| pmid | title | authors | citation |
|---|---|---|---|
| 26742850 | Rhizobiales-like Phosphatase 2 from Arabidopsis thaliana Is a Novel Phospho-tyrosine-specific Phospho-protein Phosphatase (PPP) Family Protein Phosphatase | Uhrig RG, Labandera AM, Muhammad J, Samuel M, Moorhead GB. | J Biol Chem. 2016 Mar 11;291(11):5926-5934. doi: 10.1074/jbc.M115.683656. Epub 2016 Jan 7. |
| 19889946 | Molecular complex of three testis-specific isozymes associated with the mouse sperm fibrous sheath: hexokinase 1, phosphofructokinase M, and glutathione S-transferase mu class 5 | Nakamura N, Mori C, Eddy EM. | Biol Reprod. 2010 Mar;82(3):504-15. doi: 10.1095/biolreprod.109.080580. Epub 2009 Nov 4. |
Protocols
| relevant to this product |
|---|
| ELISA |
Documents
| # | |||
|---|---|---|---|
| No results found | |||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.