Skip to content

rabbit anti-GST polyclonal antibody 3104

Price range: $100.00 through $2,600.00

Antibody summary

  • Rabbit polyclonal to GST
  • Suitable for: ELISA
  • Reacts with: tagged fusion proteins
  • Isotype: IgG
  • 100 µg, 25 µg, 1 mg
SKU: 3104parent Categories: , Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

rabbit

isotype

IgG

clonality

polyclonal

concentration

1 mg/mL

applications

ELISA

reactivity

tagged fusion proteins

available sizes

1 mg, 100 µg, 25 µg

rabbit anti-GST polyclonal antibody 3104

antibody
Database link:
GST tag P08515
Sequence- MSPILGYWKIKGLVQPTRLLLEYLEEKYEE HLYERDEGDKWRNKKFELGLEFPNLPYYID GDVKLTQSMAIIRYIADKHNMLGGCPKERA EISMLEGAVLDIRYGVSRIAYSKDFETLKV DFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFK KRIEAIPQIDKYLKSSKYIAWPLQGWQATF GGGDHPPKSD
Tested applications
ELISA
Recommended dilutions
user optimized
Application Notes
This antibody reacts with GST as determined by IEP and ELISA techniques. It is suitable for blotting, ELISA and IHC applications. Optimal working dilutions should be determined experimentally by the investigator.
Immunogen
Highly purified Glutathione-S-transferase (GST) from Schistosoma japonicum
Size and concentration
25, 100, 1000µg and 1 mg/mL
Form
liquid
Storage Instructions
2-8°C
Storage buffer
PBS, pH 7.2, 0.09% NaN3
Purity
affinity purified
Clonality
polyclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
GST can be used as a tag to aid in the expression and folding of fusion proteins. This antibody can be used to confirm expression and quantify the GST tagged recombinant proteins in Western blotting and for their purification/copurification. When imaging in situ, GST tagged proteins can be identified by this antibody when used in conjunction with a suitable secondary antibody.

Click for more on: epitope tags and GST tag
Protein names
Glutathione S-transferase
Biotechnology
GST fusion proteins, referring to Glutathione S-transferase fusion proteins, have become invaluable tools in molecular biology and biotechnology. GST, an enzyme naturally present in cells, is fused with the protein of interest to facilitate recombinant protein production and purification. The GST tag not only enhances the solubility and stability of the target protein but also allows for easy isolation using affinity chromatography with glutathione-linked resin. The specific and high-affinity interaction between GST and glutathione simplifies the purification process, resulting in highly pure and functional fusion proteins. Moreover, GST fusion proteins are widely used in protein-protein interaction studies, as they can help identify binding partners and elucidate complex signaling pathways. Additionally, GST fusion proteins serve as efficient antigens for generating antibodies, enabling researchers to produce specific and high-quality antibodies for various applications. The versatility and ease of use of GST fusion proteins make them indispensable in a wide range of research endeavors, from understanding protein function to drug discovery and beyond.

Data

ICC/IF-image-rabbit-anti-GST-polyclonal-antibody-3104
Left rabbit anti-GST polyclonal antibody 3104 labeled with anti-rabbit FITC conjugate (green). Center DAPI (blue). Right merged.
WB-image-rabbit-anti-GST-polyclonal-antibody-3104
The expression of GST was determined by Western blot. CHO cells were transfected with pcDNA3-12 Tags (CHO-12 Tag). The 10µg whole cell lysates of CHO-12 Tag, and CHO were loaded then incubated with rabbit anti-GST polyclonal antibody 3104 at 1:2000 (dilution 0.5 µg/mL) for 1h at room temperature and followed with goat anti-rabbit IgG HRP at 1:5000 dilution (0.2µg/mL) incubation for 1h at room temperature.

FAQ & Publications

Frequently Asked Questions
What applications is the rabbit anti-GST polyclonal antibody 3104 suitable for?
This antibody is suitable for ELISA, blotting, and immunohistochemistry (IHC) applications.
What is the recommended storage condition for the rabbit anti-GST polyclonal antibody 3104?
The antibody should be stored at 2-8°C in PBS buffer, pH 7.2, containing 0.09% sodium azide.
Which species does the rabbit anti-GST polyclonal antibody 3104 host come from, and what is its clonality?
The host species is rabbit, and the antibody is polyclonal with an IgG isotype.
What is the immunogen used to generate the rabbit anti-GST polyclonal antibody 3104?
The immunogen is highly purified Glutathione-S-transferase (GST) derived from Schistosoma japonicum.
Can the rabbit anti-GST polyclonal antibody 3104 be used with secondary antibodies, and if so, which ones are compatible?
Yes, it is compatible with goat anti-rabbit IgG secondary antibodies conjugated to peroxidase, biotin, or FITC, including chain-specific and cross-absorbed variants.
Publications
pmid title authors citation
26742850 Rhizobiales-like Phosphatase 2 from Arabidopsis thaliana Is a Novel Phospho-tyrosine-specific Phospho-protein Phosphatase (PPP) Family Protein Phosphatase. R Glen Uhrig, Anne-Marie Labandera, Jamshed Muhammad, Marcus Samuel, Greg B Moorhead J Biol Chem 291:5926-5934
19889946 Molecular complex of three testis-specific isozymes associated with the mouse sperm fibrous sheath: hexokinase 1, phosphofructokinase M, and glutathione S-transferase mu class 5. Noriko Nakamura, Chisato Mori, Edward M Eddy Biol Reprod 82:504-15

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
ELISA

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.