rabbit anti-BSA polyclonal antibody 7239

Price range: $100.00 through $2,600.00

Antibody summary

Rabbit polyclonal to BSA
Suitable for: ELISA
Reacts with: cow
Isotype: IgG
100 µg, 25 µg, 1 mg

available sizes

Clear

SKU: 7239parent Categories: antibody, epitope tag Tag: BSA

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	rabbit
isotype	IgG
clonality	polyclonal
concentration	1 mg/mL
applications	ELISA
reactivity	cow
available sizes	1 mg, 100 µg, 25 µg

rabbit anti-BSA polyclonal antibody 7239

antibody
Database link: bovine P02769
Tested applications ELISA
Recommended dilutions user optimized
Application Notes This antibody reacts with BSA as determined by IEP and ELISA techniques. It is suitable for blotting, ELISA and lateral flow. This antibody may cross react with albumin from other species. Optimal working dilutions should be determined experimentally by the investigator.
Immunogen Highly purified bovine serum albumin (BSA)
Size and concentration 25, 100, 1000µg and 1 mg/mL
Form liquid
Storage Instructions 2-8°C
Storage buffer PBS, pH 7.2, 0.09% NaN₃
Purity affinity purified
Clonality polyclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Bos taurus ALB Albumin
Protein names Albumin
Alternative names BSA
Gene names ALB
Protein family Belongs to the ALB/AFP/VDB family
Function Binds water, Ca(2+), Na(+), K(+), fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloidal osmotic pressure of blood. Major zinc transporter in plasma, typically binds about 80% of all plasma zinc (By similarity). Major calcium and magnesium transporter in plasma, binds approximately 45% of circulating calcium and magnesium in plasma (Probable). Potentially has more than two calcium-binding sites and might additionally bind calcium in a non-specific manner (PubMed:22677715). The shared binding site between zinc and calcium at residue Asp-272 suggests a crosstalk between zinc and calcium transport in the blood (Probable). The rank order of affinity is zinc > calcium > magnesium (Probable). Binds to the bacterial siderophore enterobactin and inhibits enterobactin-mediated iron uptake of E.coli, and may thereby limit the utilization of iron and growth of enteric bacteria such as E.coli (PubMed:6234017). Does not prevent iron uptake by the bacterial siderophore aerobactin (PubMed:6234017)
Subcellular location Secreted
Structure Interacts with FCGRT; this interaction regulates ALB homeostasis (By similarity). Interacts with TASOR (By similarity). In plasma, occurs in a covalently-linked complex with chromophore-bound alpha-1-microglobulin; this interaction does not prevent fatty acid binding to ALB
Post-translational modification Phosphorylated by FAM20C in the extracellular medium
Keywords 3D-structure, Allergen, Calcium, Cleavage on pair of basic residues, Copper, Direct protein sequencing, Disulfide bond, Glycation, Glycoprotein, Lipid-binding, Metal-binding, Methylation, Phosphoprotein, Reference proteome, Repeat, Secreted, Signal, Zinc
Sequence MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPF DEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEP ERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYY ANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVA RLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKE CCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRR HPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEK LGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLIL NRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLP DTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVV STQTALA
UniProt accession: P02769

Data

ELISA-image-rabbit-anti-BSA-polyclonal-antibody-7239

FAQ & Publications

Frequently Asked Questions

What applications is the rabbit anti-BSA polyclonal antibody 7239 validated for?

This antibody has been tested and is suitable for ELISA, blotting, and lateral flow assays.

How should the rabbit anti-BSA polyclonal antibody 7239 be stored to maintain stability?

The antibody should be stored refrigerated at 2-8°C in PBS buffer at pH 7.2 containing 0.09% sodium azide.

Which species does the rabbit anti-BSA polyclonal antibody 7239 react with?

This antibody specifically reacts with bovine serum albumin (BSA) from cow and may cross-react with albumin from other species.

What are the available sizes and concentration of the rabbit anti-BSA polyclonal antibody 7239?

The antibody is available in sizes of 25 µg, 100 µg, and 1 mg, all supplied at a concentration of 1 mg/mL in liquid form.

Publications

pmid	title	authors	citation
36910947	Synthesis of C3,C6-Diaryl 7-Azaindoles via One-Pot Suzuki-Miyaura Cross-Coupling Reaction and Evaluation of Their HIV-1 Integrase Inhibitory Activity.	Savio Cardoza, Pooja Yadav, Abhishek Ajmani, Parthasarathi Das, Vibha Tandon	ACS Omega 8:8415-8426

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.