Migration Assay: Cells expressing recombinant CCR5 were assayed for migration through a transwell filter at various concentrations of MIP-1b. Responses are expressed as the % of total input cells.

Macrophage inflammatory proteins 1-B (MIP-1B/CCL4) 6005

Price range: $61.00 through $2,189.00

Summary

Expression: E.coli
Amino Acid Range: 24-92

available size

Clear

SKU: 6005parent Categories: chemokine, proteins Tag: CCL4 (MIP-1B)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
accession	P13236
express system	E.coli
product tag	none
purity	> 97% by SDS PAGE
molecular weight	Predicted Molecular Mass: 7.818 kDa Extinction Coefficient: 12, 570 M-1 cm-1 Actual Molecular Mass (Mass Spec): 7.818 kDa by ESI Mass Spec
available size	100 µg, 1mg, 20 µg, 5 µg, 50 µg
endotoxin	<0.01 EU per 1μg of the protein by the LAL method
sequence	APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSES WVQEYVYDLELN

Macrophage inflammatory proteins 1-B (MIP-1B/CCL4) 6005

antibody
Database link: human P13236
Size and concentration 5, 20, 50, 100, 1000µg and lyophilized
Form Lyophilized
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp
Purity > 97% by SDS PAGE and HPLC

target relevance
Homo sapiens CCL4 C-C motif chemokine 4
Protein names C-C motif chemokine 4
Alternative names G-26 T-lymphocyte-secreted protein, HC21, Lymphocyte activation gene 1 protein, MIP-1-beta(1-69), Macrophage inflammatory protein 1-beta, PAT 744, Protein H400, SIS-gamma, Small-inducible cytokine A4, T-cell activation protein 2
Gene names CCL4
Protein family Belongs to the intercrine beta (chemokine CC) family
Function Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B
Subcellular location Secreted
Structure Homodimer and heterodimer of MIP-1-alpha(4-69) and MIP-1-beta(3-69)
Post-translational modification N-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes
Keywords 3D-structure, Chemotaxis, Cytokine, Disulfide bond, Inflammatory response, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ PAVVFQTKRSKQVCADPSESWVQEYVYDLELN
UniProt accession: P13236

Data

Migration Assay: Cells expressing recombinant CCR5 were assayed for migration through a transwell filter at various concentrations of MIP-1b. Responses are expressed as the % of total input cells.

FAQ & Publications

Frequently Asked Questions

What is the recommended storage condition and stability for the Macrophage Inflammatory Protein 1-B (MIP-1B/CCL4) product?

The lyophilized product should be stored at -20 to -70 °C and is stable for 12 months from the date of receipt. After reconstitution, it can be kept for 1 month at 2 to 8 °C under sterile conditions or for 3 months at -20 to -70 °C under sterile conditions. Avoid repeated freeze-thaw cycles to maintain protein integrity.

What is the source expression system and purity level of this recombinant MIP-1B/CCL4 protein?

This recombinant MIP-1B/CCL4 protein is expressed in Escherichia coli (E.coli) and has a purity greater than 97% as determined by SDS-PAGE and HPLC analyses.

What is the biological relevance of MIP-1B/CCL4 and its known interactions with chemokine receptors?

MIP-1B/CCL4 is a monokine with inflammatory and chemokinetic properties that binds primarily to the CCR5 receptor. It acts as a major HIV-suppressive factor produced by CD8+ T-cells and induces dose-dependent inhibition of HIV-1, HIV-2, and SIV strains. The processed form, MIP-1-beta(3-69), can down-modulate CCR5 surface expression and inhibit CCR5-mediated HIV-1 entry into T-cells, and it also acts as a ligand for CCR1 and CCR2 isoform B.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.