Migration Assay: Cells expressing recombinant CCR5 were assayed for migration through a transwell filter at various concentrations of MIP-1b. Responses are expressed as the % of total input cells.

Macrophage inflammatory proteins 1-B (MIP-1B/CCL4) 6005

$61.00 – $2,189.00

Summary

Expression: E.coli
Amino Acid Range: 24-92

SKU: 6005parent Categories: chemokine, proteins Tag: CCL4 (MIP-1B)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
accession	P13236
express system	E.coli
product tag	none
purity	> 97% by SDS PAGE
molecular weight	Predicted Molecular Mass: 7.818 kDa Extinction Coefficient: 12, 570 M-1 cm-1 Actual Molecular Mass (Mass Spec): 7.818 kDa by ESI Mass Spec
available size	10 µg, 100 µg, 2 µg, 50 µg
endotoxin	<0.01 EU per 1μg of the protein by the LAL method
sequence	APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSES WVQEYVYDLELN

Macrophage inflammatory proteins 1-B (MIP-1B/CCL4) 6005

protein
Database link: human P13236
Size and concentration 5, 20, 50, 100, 1000µg and lyophilized
Form Lyophilized
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp
Purity > 97% by SDS PAGE and HPLC

target relevance
Monokine with inflammatory and chemokinetic properties binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.
Protein names C-C motif chemokine 4 (G-26 T-lymphocyte-secreted protein) (HC21) (Lymphocyte activation gene 1 protein) (LAG-1) (MIP-1-beta(1-69)) (Macrophage inflammatory protein 1-beta) (MIP-1-beta) (PAT 744) (Protein H400) (SIS-gamma) (Small-inducible cytokine A4) (T-cell activation protein 2) (ACT-2) [Cleaved into: MIP-1-beta(3-69)]
Gene names CCL4,CCL4 LAG1 MIP1B SCYA4
Protein family Intercrine beta (chemokine CC) family
Mass 10212Da
Function Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.
Subellular location Secreted.
Structure Homodimer and heterodimer of MIP-1-alpha(4-69) and MIP-1-beta(3-69).
Post-translational modification N-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes.
Target Relevance information above includes information from UniProt accession: P13236
The UniProt Consortium

Data

Migration Assay: Cells expressing recombinant CCR5 were assayed for migration through a transwell filter at various concentrations of MIP-1b. Responses are expressed as the % of total input cells.

Publications

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from PubMed database provided by The United States National Library of Medicine at the National Institutes of Health.