Migration Assay: Cells expressing recombinant CCR5 were assayed for migration through a transwell filter at various concentrations of WT or Biotinylated MIP-1α. Responses are expressed as the % of total input cells (Blue: wild type; Red: biotinylated).

Biotinylated Macrophage inflammatory proteins 1-a (MIP1a) 8017

Price range: $134.00 through $3,368.00

Summary

Expression: E.coli
Amino Acid Range: 24-92

available size

Clear

SKU: 8017parent Categories: chemokine, proteins Tag: CCL3 (MIP-1a)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
accession	P10147
express system	E.coli
product tag	biotin at C-terminal
purity	> 97% by SDS PAGE
molecular weight	Predicted Molecular Mass: 10,237.4973 Da Extinction Coefficient: 18,020 M-1 cm-1 Actual Molecular Mass: 10,237.4973 Da by ESI Mass Spec
available size	100 µg, 20 µg, 5 µg, 50 µg
endotoxin	<0.01 EU per 1μg of the protein by the LAL method

Biotinylated Macrophage inflammatory proteins 1-a (MIP1a) 8017

antibody
Database link: human P10147
Size and concentration 2, 10, 50, 100µg and lyophilized
Form Lyophilized
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp
Purity > 97% by SDS PAGE and HPLC

target relevance
Homo sapiens CCL3 C-C motif chemokine 3
Protein names C-C motif chemokine 3
Alternative names G0/G1 switch regulatory protein 19-1, Macrophage inflammatory protein 1-alpha, PAT 464.1, SIS-beta, Small-inducible cytokine A3, Tonsillar lymphocyte LD78 alpha protein
Gene names CCL3
Protein family Belongs to the intercrine beta (chemokine CC) family
Function Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV)
Subcellular location Secreted
Structure Self-associates. Also heterodimer of MIP-1-alpha(4-69) and MIP-1-beta(3-69) (PubMed:12070155). Interacts with CCR1 (PubMed:15905581)
Post-translational modification N-terminal processed form LD78-alpha(4-69) is produced by proteolytic cleavage after secretion from HTLV1-transformed T-cells
Keywords 3D-structure, Chemotaxis, Cytokine, Direct protein sequencing, Disulfide bond, Inflammatory response, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
UniProt accession: P10147

Data

Migration Assay: Cells expressing recombinant CCR5 were assayed for migration through a transwell filter at various concentrations of WT or Biotinylated MIP-1α. Responses are expressed as the % of total input cells (Blue: wild type; Red: biotinylated).

FAQ & Publications

Frequently Asked Questions

What is the recommended storage condition for the Biotinylated Macrophage Inflammatory Protein 1-a (MIP1a) to maintain its stability?

The lyophilized product should be stored at -20 to -70 °C and is stable for 12 months from the date of receipt. After reconstitution, it can be stored at 2 to 8 °C for 1 month or at -20 to -70 °C for up to 3 months under sterile conditions. Avoid repeated freeze-thaw cycles to maintain protein integrity.

What expression system is used to produce this Biotinylated MIP1a protein, and what is the purity level?

This Biotinylated MIP1a protein is expressed in Escherichia coli (E.coli) cells. The purity of the protein is greater than 97%, confirmed by SDS-PAGE and HPLC analysis.

How is the biotin conjugation performed on MIP1a, and what are the advantages of this method?

The biotinylation of MIP1a is achieved enzymatically at a specific lysine residue located at the C-terminal, resulting in a biotinylated protein with functional properties comparable to the unmodified chemokine. This method has advantages over chemical biotinylation as it preserves biological activity and allows for precise labeling, facilitating receptor identification, chemokine binding studies, and cellular assays without the need for radioactive labeling.

What applications is the Biotinylated Macrophage Inflammatory Protein 1-a (MIP1a) suitable for in research?

Biotinylated MIP1a is useful in studies involving receptor identification and distribution, chemokine binding, and various cellular assays including migration assays. It can be combined with avidin analogues conjugated to fluorescent labels for visualization and quantification of chemokine-receptor interactions, making it a valuable tool in immunological and cell signaling research.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.