| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| accession | P02778 |
| express system | E.coli |
| product tag | none |
| purity | > 97% by SDS PAGE |
| molecular weight | Actual Molecular Mass: 8.6 kDa by ESI Mass Spec Predicted Molecular Mass: 8.6 kDa Extinction Coefficient: 480 M-1 cm-1 (A280), 11 (mg/ml•cm)-1 (A220) |
| available size | 100 µg, 1mg, 20 µg, 5 µg, 50 µg |
| endotoxin | <0.01 EU per 1μg of the protein by the LAL method |
| sequence | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKERSKRSP |
Interferon gamma-induced protein 10 (IP-10/CXCL10) 8014
Price range: $61.00 through $2,189.00
Summary
- Expression: E.coli
- Amino Acid Range: 22-98
Interferon gamma-induced protein 10 (IP-10/CXCL10) 8014
| antibody |
|---|
| Database link: human P02778 |
| Size and concentration 5, 20, 50, 100, 1000µg and lyophilized |
| Form Lyophilized |
| Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution |
| Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp |
| Purity > 97% by SDS PAGE and HPLC |
| target relevance |
|---|
| Homo sapiens CXCL10 C-X-C motif chemokine 10 |
| Protein names C-X-C motif chemokine 10 |
| Alternative names 10 kDa interferon gamma-induced protein, Small-inducible cytokine B10 |
| Gene names CXCL10 |
| Protein family Belongs to the intercrine alpha (chemokine CxC) family |
| Function Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects (PubMed:11157474, PubMed:22652417, PubMed:7540647). Plays thereby an important role during viral infections by stimulating the activation and migration of immune cells to the infected sites (By similarity). Mechanistically, binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling and results in downstream activation of phospholipase C-dependent pathway, an increase in intracellular calcium production and actin reorganization (PubMed:12750173, PubMed:19151743). In turn, recruitment of activated Th1 lymphocytes occurs at sites of inflammation (PubMed:12663757, PubMed:12750173). Activation of the CXCL10/CXCR3 axis also plays an important role in neurons in response to brain injury for activating microglia, the resident macrophage population of the central nervous system, and directing them to the lesion site. This recruitment is an essential element for neuronal reorganization (By similarity) |
| Subcellular location Secreted |
| Structure Monomer, dimer, and tetramer (PubMed:12737818). Interacts with CXCR3 (via N-terminus) (PubMed:19151743) |
| Post-translational modification Several proteases can mediate post-secretion cleavages. DPP4 cleaves CXCL10 on its N-terminal 2 amino acids leading to an antagonist form of CXCL10. This dominant negative form is capable of binding CXCR3 but does not induce signaling. MMP9 cleaves 9 amino acids instead |
| Keywords 3D-structure, Chemotaxis, Citrullination, Cytokine, Direct protein sequencing, Disulfide bond, Inflammatory response, Proteomics identification, Reference proteome, Secreted, Signal |
| Sequence MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRV EIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
| UniProt accession: P02778 |
Data
![]() |
| Migration Assay: Cells expressing recombinant CXCR3 were assayed for migration through a transwell filter at various concentrations of WT IP-10. Responses are expressed as the % of total input cells. |
FAQ & Publications
Frequently Asked Questions
What is the recommended storage protocol for Interferon gamma-induced protein 10 (IP-10/CXCL10) 8014 after reconstitution?
After reconstitution, it is recommended to store the protein under sterile conditions at 2 to 8 °C for up to 1 month, or at -20 to -70 °C for up to 3 months to maintain stability.
Which expression system is used for the production of the IP-10/CXCL10 8014 protein, and what is its purity?
The IP-10/CXCL10 8014 protein is expressed in Escherichia coli (E.coli) and has a purity greater than 97% as determined by SDS-PAGE and HPLC.
What is the biological role and receptor target of the IP-10/CXCL10 protein provided in this product?
IP-10/CXCL10 is a pro-inflammatory chemokine that signals through the CXCR3 receptor to selectively attract Th1 lymphocytes and monocytes. It plays important roles in chemotaxis, immune cell activation, modulation of angiostatic effects, and neuronal response to injury.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Migration assay |
Documents
| # | ||
|---|---|---|
| Please enter your product and batch number here. | ||
Only logged in customers who have purchased this product may leave a review.

















Reviews
There are no reviews yet.