Migration Assay: Jurkat cells expressing endogenous CXCR4 were assayed for migration through a transwell filter at various concentrations of WT SDF-1α. Responses are expressed as the % of total input cells

Stromal-Cell Derived Factor-1a (SDF-1a/CXCL12) 8015

Price range: $61.00 through $2,189.00

Summary

Expression: E.coli
Amino Acid Range: 22-89

available size

Clear

SKU: 8015parent Categories: chemokine, proteins Tag: CXCL12 (SDF-1a)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
accession	P48061-2
express system	E.coli
product tag	none
purity	> 97% by SDS PAGE
molecular weight	Predicted Molecular Mass: 7.963 kDa Extinction Coefficient: 8,730 M-1 cm-1 Actual Molecular Mass: 7.98 kDa by ESI Mass Spec
available size	100 µg, 1mg, 20 µg, 5 µg, 50 µg
endotoxin	<0.01 EU per 1μg of the protein by the LAL method
sequence	KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKL KWIQEYLEKALNK

Stromal-Cell Derived Factor-1a (SDF-1a/CXCL12) 8015

antibody
Database link: human P48061-2
Size and concentration 5, 20, 50, 100, 1000µg and lyophilized
Form Lyophilized
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp
Purity > 97% by SDS PAGE and HPLC

target relevance
Homo sapiens CXCL12 Stromal cell-derived factor 1
Protein names Stromal cell-derived factor 1
Alternative names C-X-C motif chemokine 12, Intercrine reduced in hepatomas, Pre-B cell growth-stimulating factor
Gene names CXCL12
Protein family Belongs to the intercrine alpha (chemokine CxC) family
Function Chemoattractant active on T-lymphocytes and monocytes but not neutrophils (PubMed:18802065, PubMed:39093700). Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis (PubMed:8752281, PubMed:18802065, PubMed:39093700). Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for CXCL12/SDF-1 (PubMed:16107333, PubMed:19255243). Binds to the allosteric site (site 2) of integrins and activates integrins ITGAV:ITGB3, ITGA4:ITGB1 and ITGA5:ITGB1 in a CXCR4-independent manner (PubMed:29301984). Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase (PubMed:18802065). Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins (PubMed:16107333, PubMed:18802065, PubMed:19255243, PubMed:39093700). CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase (PubMed:18802065). Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1 (PubMed:8752281). Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation (By similarity). Stimulates the proliferation of bone marrow-derived B-cell progenitors in the presence of IL7 as well as growth of stromal cell-dependent pre-B-cells (By similarity)
Subcellular location Secreted
Structure (Microbial infection) Interacts with molluscum contagiosum virus protein MC148
Post-translational modification Processed forms SDF-1-beta(3-72) and SDF-1-alpha(3-67) are produced after secretion by proteolytic cleavage of isoforms Beta and Alpha, respectively. The N-terminal processing is probably achieved by DPP4. Isoform Alpha is first cleaved at the C-terminus to yield a SDF-1-alpha(1-67) intermediate before being processed at the N-terminus. The C-terminal processing of isoform Alpha is reduced by binding to heparin and, probably, cell surface proteoglycans
Keywords 3D-structure, Alternative splicing, Chemotaxis, Cytokine, Disulfide bond, Growth factor, Host-virus interaction, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV ARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
UniProt accession: P48061

Data

Migration Assay: Jurkat cells expressing endogenous CXCR4 were assayed for migration through a transwell filter at various concentrations of WT SDF-1a. Responses are expressed as the % of total input cells

FAQ & Publications

Frequently Asked Questions

What is the recommended storage condition for the Stromal-Cell Derived Factor-1a (SDF-1a/CXCL12) 8015 after reconstitution?

After reconstitution, the product should be stored under sterile conditions at 2 to 8 °C for up to 1 month or at -20 to -70 °C for up to 3 months. Avoid repeated freeze-thaw cycles to maintain protein integrity.

What is the purity and molecular weight of the SDF-1a protein provided in this product?

The SDF-1a protein in this product has a purity greater than 97% as determined by SDS PAGE and HPLC. The predicted molecular mass is approximately 7.963 kDa, with the actual molecular mass confirmed at 7.98 kDa by ESI Mass Spectrometry.

Which expression system is used to produce the Stromal-Cell Derived Factor-1a (SDF-1a/CXCL12) 8015?

This protein is expressed using the Escherichia coli (E.coli) expression system.

What biological functions and receptor interactions are associated with SDF-1a (CXCL12) in this product?

SDF-1a (CXCL12) acts as a chemoattractant for T-lymphocytes and monocytes and binds to the CXCR4 receptor to induce intracellular calcium mobilization and chemotaxis. It also binds to the atypical chemokine receptor ACKR3, activating beta-arrestin signaling rather than G protein pathways, and interacts with integrins independently of CXCR4. The protein plays roles in embryogenesis, angiogenesis, immune cell migration, HIV-1 infection inhibition, and myocardial protection.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.