| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| accession | P13500 |
| express system | E.coli |
| product tag | none |
| purity | > 97% by SDS PAGE |
| molecular weight | Predicted Molecular Mass: 8.666 kDa Extinction Coefficient: 8,730 M-1 cm-1 Actual Molecular Mass (Mass Spec): 8.666 kDa by ESI Mass Spec |
| available size | 100 µg, 1mg, 20 µg, 5 µg, 50 µg |
| endotoxin | <0.01 EU per 1μg of the protein by the LAL method |
| sequence | QPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWVQDSIDHLDKQTQTPKT |
Monocyte Chemoattractant Protein-1 (MCP-1/CCL2) 8016
Price range: $61.00 through $2,189.00
Summary
- Expression: E.coli
- Amino Acid Range: 28-99
Monocyte Chemoattractant Protein-1 (MCP-1/CCL2) 8016
| antibody |
|---|
| Database link: human P13500 |
| Size and concentration 5, 20, 50, 100, 1000µg and lyophilized |
| Form Lyophilized |
| Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution |
| Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp |
| Purity > 97% by SDS PAGE and HPLC |
| target relevance |
|---|
| Homo sapiens CCL2 C-C motif chemokine 2 |
| Protein names C-C motif chemokine 2 |
| Alternative names HC11, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, Monocyte chemotactic protein 1, Monocyte secretory protein JE, Small-inducible cytokine A2 |
| Gene names CCL2 |
| Protein family Belongs to the intercrine beta (chemokine CC) family |
| Function Acts as a ligand for C-C chemokine receptor CCR2 (PubMed:10529171, PubMed:10587439, PubMed:9837883). Signals through binding and activation of CCR2 and induces a strong chemotactic response and mobilization of intracellular calcium ions (PubMed:10587439, PubMed:9837883). Exhibits a chemotactic activity for monocytes and basophils but not neutrophils or eosinophils (PubMed:8195247, PubMed:8627182, PubMed:9792674). May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis (PubMed:8107690) |
| Subcellular location Secreted |
| Structure Monomer or homodimer; in equilibrium (PubMed:15033992, PubMed:8898111, PubMed:8989326, PubMed:9837883). Is tethered on endothelial cells by glycosaminoglycan (GAG) side chains of proteoglycans (PubMed:9792674). Interacts with TNFAIP6 (via Link domain) |
| Post-translational modification Processing at the N-terminus can regulate receptor and target cell selectivity (PubMed:8627182). Deletion of the N-terminal residue converts it from an activator of basophil to an eosinophil chemoattractant (PubMed:8627182) N-Glycosylated |
| Keywords 3D-structure, Chemotaxis, Cytokine, Direct protein sequencing, Disulfide bond, Glycoprotein, Inflammatory response, Proteomics identification, Pyrrolidone carboxylic acid, Reference proteome, Secreted, Signal |
| Sequence MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT |
| UniProt accession: P13500 |
Data
![]() |
| Migration Assay: Cells expressing recombinant CXCR1 were assayed for migration through a transwell filter at various concentrations of WT IL-8. Responses are expressed as the % of total input cells. |
FAQ & Publications
Frequently Asked Questions
What expression system is used to produce Monocyte Chemoattractant Protein-1 (MCP-1/CCL2) 8016?
This MCP-1/CCL2 protein is expressed using an Escherichia coli (E.coli) expression system.
What are the recommended storage conditions for this MCP-1 product after reconstitution?
After reconstitution, the product should be stored under sterile conditions either at 2 to 8 °C for up to 1 month or at -20 to -70 °C for up to 3 months. Avoid repeated freeze-thaw cycles to maintain protein integrity.
What is the purity level of the Monocyte Chemoattractant Protein-1 provided?
The protein is purified to greater than 97% purity as confirmed by SDS PAGE and HPLC analyses.
Can you describe the biological function and target receptor interaction of MCP-1/CCL2?
MCP-1/CCL2 acts as a ligand for the C-C chemokine receptor CCR2, inducing chemotaxis and mobilization of intracellular calcium ions in monocytes and basophils. It does not affect neutrophils or eosinophils and plays a role in recruiting monocytes during inflammatory responses.
What is the endotoxin level in this MCP-1 protein preparation?
The endotoxin content is less than 0.01 endotoxin units (EU) per microgram of protein as measured by the Limulus Amebocyte Lysate (LAL) method.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Migration assay |
Documents
| # | ||
|---|---|---|
| Please enter your product and batch number here. | ||
Only logged in customers who have purchased this product may leave a review.

















Reviews
There are no reviews yet.