Migration Assay: Cells expressing recombinant CCR10 were assayed for migration through a transwell filter at various concentrations of WT or Biotinylated MEC. Responses are expressed as the % of total input cells (Blue: wild type; Red: biotinylated).

Biotinylated Mucosae-associated epithelial chemokine (MEC/CCL28) 8023

Price range: $134.00 through $2,862.00

Summary

Expression: E.coli
Amino Acid Range: 23-127

available size

Clear

SKU: 8023parent Categories: chemokine, proteins Tag: CCL28 (MEC)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
accession	Q9NRJ3
express system	E.coli
product tag	biotin at C-terminal
purity	> 97% by SDS PAGE
molecular weight	Predicted Molecular Mass: 14,490.7111 Da Extinction Coefficient: 14,300 M-1 cm-1 Actual Molecular Mass: 14,490.7111 Da by ESI Mass Spec
available size	10 µg, 100 µg, 2 µg, 50 µg
endotoxin	<0.01 EU per 1μg of the protein by the LAL method

Biotinylated Mucosae-associated epithelial chemokine (MEC/CCL28) 8023

antibody
Database link: human Q9NRJ3
Size and concentration 2, 10, 50, 100µg and lyophilized
Form Lyophilized
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp
Purity > 97% by SDS PAGE and HPLC

target relevance
Homo sapiens CCL28 C-C motif chemokine 28
Protein names C-C motif chemokine 28
Alternative names Mucosae-associated epithelial chemokine, Protein CCK1, Small-inducible cytokine A28
Gene names CCL28
Protein family Belongs to the intercrine beta (chemokine CC) family
Function Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner
Subcellular location Secreted
Keywords 3D-structure, Alternative splicing, Chemotaxis, Cytokine, Disulfide bond, Glycoprotein, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDL AAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHET YGHKTPY
UniProt accession: Q9NRJ3

Data

Migration Assay: Cells expressing recombinant CCR10 were assayed for migration through a transwell filter at various concentrations of WT or Biotinylated MEC. Responses are expressed as the % of total input cells (Blue: wild type; Red: biotinylated).

FAQ/Publications

Frequently Asked Questions

What is the recommended storage condition for the Biotinylated MEC/CCL28 protein after reconstitution?

After reconstitution, the Biotinylated MEC/CCL28 protein should be stored under sterile conditions at 2 to 8 °C for up to 1 month or at -20 to -70 °C for up to 3 months to maintain stability.

Which expression system is used for producing this Biotinylated Mucosae-associated epithelial chemokine (MEC/CCL28)?

This Biotinylated MEC/CCL28 protein is expressed using an Escherichia coli (E.coli) expression system.

What biological activities are associated with the Biotinylated MEC/CCL28 protein?

The Biotinylated MEC/CCL28 exhibits chemotactic activity for resting CD4 and CD8 T-cells and eosinophils by binding to CCR3 and CCR10 receptors, inducing calcium mobilization. It also shows broad-spectrum antibacterial activities and potential usefulness in HIV vaccination.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.