| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| accession | P10145 |
| express system | E.coli |
| product tag | none |
| purity | > 97% by SDS PAGE |
| molecular weight | Predicted Molecular Mass: 8.386 kDa Extinction Coefficient: 7,450 M-1 cm-1 Actual Molecular Mass: 8.386 kDa by ESI Mass Spec |
| available size | 100 µg, 1mg, 20 µg, 5 µg, 50 µg |
| endotoxin | <0.01 EU per 1μg of the protein by the LAL method |
| sequence | FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNP SLSQWFEHQERKLHGTLPKLNFGMLRKMG |
Human CCL27 (CTACK) 7027
Price range: $61.00 through $2,189.00
Summary
- Expression: E.coli
- Amino Acid Range: 25-112
Human CCL27 (CTACK) 7027
| protein |
|---|
| Database link: human Q9Y4X3 |
| Size and concentration 5, 20, 50, 100, 1000µg and lyophilized |
| Form Lyophilized |
| Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution |
| Storage buffer ​Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp |
| Purity > 97% by SDS PAGE and HPLC |
| target relevance |
|---|
| Cutaneous T-cell-attracting chemokine (CTACK/CCL27) is a ligand for cell surface receptor CCR10. It is responsible for chemotaxis of skin-homing memory T cells during cutaneous inflammation. Interestingly, after CCR10-mediated internalization, CTACK, as well as a non-secreted splice variant of the same gene, can reach the nucleus and modulate transcription and cell behavior. |
| Protein names C-C motif chemokine 27 (CC chemokine ILC) (Cutaneous T-cell-attracting chemokine) (CTACK) (ESkine) (IL-11 R-alpha-locus chemokine) (Skinkine) (Small-inducible cytokine A27) |
| Gene names CCL27,CCL27 ILC SCYA27 |
| Protein family Intercrine beta (chemokine CC) family |
| Mass 12618Da |
| Function FUNCTION: Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. Binds to CCR10. |
| Subellular location SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:Q9Z1X0}. |
| Tissues TISSUE SPECIFICITY: Testis, thymus, placenta, ovary and skin. |
| Structure SUBUNIT: Monomer, dimer, and tetramer. Heparin avidly promotes oligomerization. Interacts with TNFAIP6 (via Link domain). {ECO:0000269|PubMed:20200157, ECO:0000269|PubMed:27044744}. |
| Target Relevance information above includes information from UniProt accession: Q9Y4X3 |
| The UniProt Consortium |
Data
![]() |
| Migration Assay: Cells expressing recombinant CCR10 were assayed for migration through a transwell filter at various concentrations of CTACK. Responses are expressed as the % of total input cells |
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Protocols
| relevant to this product |
|---|
| Migration assay |
Documents
| # | ||
|---|---|---|
| Please enter your product and batch number here. | ||
Only logged in customers who have purchased this product may leave a review.
















Reviews
There are no reviews yet.