Migration Assay: Cells expressing recombinant CCR10 were assayed for migration through a transwell filter at various concentrations of CTACK. Responses are expressed as the % of total input cells.

Human CCL27 (CTACK) 7027

Price range: $61.00 through $2,189.00

Summary

Expression: E.coli
Amino Acid Range: 25-112

available size

Clear

SKU: 7027parent Categories: chemokine, proteins Tag: CCL27 (CTACK)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
accession	P10145
express system	E.coli
product tag	none
purity	> 97% by SDS PAGE
molecular weight	Predicted Molecular Mass: 8.386 kDa Extinction Coefficient: 7,450 M-1 cm-1 Actual Molecular Mass: 8.386 kDa by ESI Mass Spec
available size	100 µg, 1mg, 20 µg, 5 µg, 50 µg
endotoxin	<0.01 EU per 1μg of the protein by the LAL method
sequence	FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNP SLSQWFEHQERKLHGTLPKLNFGMLRKMG

Human CCL27 (CTACK) 7027

antibody
Database link: human Q9Y4X3
Size and concentration 5, 20, 50, 100, 1000µg and lyophilized
Form Lyophilized
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp
Purity > 97% by SDS PAGE and HPLC

target relevance
Homo sapiens CCL27 C-C motif chemokine 27
Protein names C-C motif chemokine 27
Alternative names CC chemokine ILC, Cutaneous T-cell-attracting chemokine, ESkine, IL-11 R-alpha-locus chemokine, Skinkine, Small-inducible cytokine A27
Gene names CCL27
Protein family Belongs to the intercrine beta (chemokine CC) family
Function Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. Binds to CCR10
Subcellular location Secreted
Structure Monomer, dimer, and tetramer. Heparin avidly promotes oligomerization. Interacts with TNFAIP6 (via Link domain)
Keywords 3D-structure, Cytokine, Direct protein sequencing, Disulfide bond, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADG DCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
UniProt accession: Q9Y4X3

Data

Migration Assay: Cells expressing recombinant CCR10 were assayed for migration through a transwell filter at various concentrations of CTACK. Responses are expressed as the % of total input cells

FAQ & Publications

Frequently Asked Questions

What organism is the Human CCL27 (CTACK) 7027 protein expressed in?

The Human CCL27 (CTACK) 7027 protein is expressed in Escherichia coli (E.coli).

How should the Human CCL27 (CTACK) 7027 protein be stored after reconstitution?

After reconstitution, the protein can be stored for 1 month at 2 to 8 °C under sterile conditions or for 3 months at -20 to -70 °C under sterile conditions. Avoid repeated freeze-thaw cycles.

What is the purity level of Human CCL27 (CTACK) 7027, and how is it determined?

The purity of Human CCL27 (CTACK) 7027 is greater than 97%, as determined by SDS-PAGE and HPLC analysis.

What is the endotoxin level present in the Human CCL27 (CTACK) 7027 protein preparation?

The endotoxin level is less than 0.01 Endotoxin Units (EU) per 1 microgram of protein, measured by the Limulus Amebocyte Lysate (LAL) method.

Which receptor does CCL27 (CTACK) bind to, and what is its biological function?

CCL27 (CTACK) binds to the CCR10 receptor and functions as a chemotactic factor attracting skin-associated memory T-lymphocytes, playing a role in lymphocyte homing to cutaneous sites.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.