Chemokine Induced Migration Cells expressing recombinant CXCR1 were assayed for migration through the transwell bare filter at various concentrations of IL-8. The response is expressed as the % of total input cells (Blue: wild type; Red: biotinylated).

CXCL8-Biotin Detection on PAGE Gel Detection of various amounts (1-62 ng) of Biotinylated-CXCL8 with streptavidin conjugated to 800CW dye (LiCOR).

Biotinylated Interleukin 8 (IL-8 /CXCL8) 8024

Price range: $134.00 through $2,862.00

Summary

Expression: E.coli
Amino Acid Range: 28-99

available size

Clear

SKU: 8024parent Categories: chemokine, proteins Tag: CXCL8 (IL-8)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
accession	P10145
express system	E.coli
product tag	biotin at C-terminal
purity	> 97% by SDS PAGE
molecular weight	Predicted Molecular Mass: 10,803.49 Da Extinction Coefficient: 12,900 M-1 cm-1 Actual Molecular Mass: 10,803 Da by ESI Mass Spec
available size	10 µg, 100 µg, 2 µg, 50 µg
endotoxin	<0.01 EU per 1μg of the protein by the LAL method

Biotinylated Interleukin 8 (IL-8 /CXCL8) 8024

antibody
Database link: human P10145
Size and concentration 2, 10, 50, 100µg and lyophilized
Form Lyophilized
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp
Purity > 97% by SDS PAGE and HPLC

target relevance
Homo sapiens CXCL8 Interleukin-8
Protein names Interleukin-8
Alternative names C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Emoctakin, Granulocyte chemotactic protein 1, Monocyte-derived neutrophil chemotactic factor, Monocyte-derived neutrophil-activating peptide, Neutrophil-activating protein 1, Protein 3-10C, T-cell chemotactic factor
Gene names CXCL8
Protein family Belongs to the intercrine alpha (chemokine CxC) family
Function Chemotactic factor that mediates inflammatory response by attracting neutrophils, basophils, and T-cells to clear pathogens and protect the host from infection (PubMed:18692776, PubMed:7636208). Also plays an important role in neutrophil activation (PubMed:2145175, PubMed:9623510). Released in response to an inflammatory stimulus, exerts its effect by binding to the G-protein-coupled receptors CXCR1 and CXCR2, primarily found in neutrophils, monocytes and endothelial cells (PubMed:1840701, PubMed:1891716). G-protein heterotrimer (alpha, beta, gamma subunits) constitutively binds to CXCR1/CXCR2 receptor and activation by IL8 leads to beta and gamma subunits release from Galpha (GNAI2 in neutrophils) and activation of several downstream signaling pathways including PI3K and MAPK pathways (PubMed:11971003, PubMed:8662698)
Subcellular location Secreted
Structure Homodimer (PubMed:31235521). Dimer formation is disrupted by tick evasin-3 (PubMed:31235521). Interacts with TNFAIP6 (via Link domain); this interaction interferes with chemokine binding to glycosaminoglycans
Post-translational modification Several N-terminal processed forms are produced by proteolytic cleavage after secretion from at least peripheral blood monocytes, leukcocytes and endothelial cells. In general, IL-8(1-77) is referred to as interleukin-8. IL-8(6-77) is the most promiment form Citrullination at Arg-27 prevents proteolysis, and dampens tissue inflammation, it also enhances leukocytosis, possibly through impaired chemokine clearance from the blood circulation (Microbial infection) Cleaved by group A Streptococcus protease SpyCEP; leading to impaired neutrophil endothelial transmigration and thus increased virulence
Keywords 3D-structure, Chemotaxis, Citrullination, Cytokine, Direct protein sequencing, Disulfide bond, Inflammatory response, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
UniProt accession: P10145

Data

Chemokine Induced Migration Cells expressing recombinant CXCR1 were assayed for migration through the transwell bare filter at various concentrations of IL-8. The response is expressed as the % of total input cells (Blue: wild type; Red: biotinylated).

CXCL8-Biotin Detection on PAGE Gel Detection of various amounts (1-62 ng) of Biotinylated-CXCL8 with streptavidin conjugated to 800CW dye (LiCOR).

FAQ & Publications

Frequently Asked Questions

What is the source of expression for Biotinylated Interleukin 8 (IL-8/CXCL8) 8024?

The protein is expressed in Escherichia coli (E.coli).

How should Biotinylated Interleukin 8 (IL-8/CXCL8) 8024 be stored after reconstitution?

After reconstitution, store the product at 2 to 8 °C under sterile conditions for up to 1 month or at -20 to -70 °C under sterile conditions for up to 3 months. Avoid repeated freeze-thaw cycles.

What is the purity level of this Biotinylated IL-8 product?

The product has a purity greater than 97% as determined by SDS-PAGE and HPLC analyses.

What functional advantages does the enzymatic biotinylation of CXCL8 offer?

Enzymatic biotinylation attaches biotin specifically at a lysine residue with nearly 100% completeness, preserving functional activity comparable to unmodified CXCL8 in migration assays. This modification facilitates receptor identification, chemokine binding studies, and cellular assays using avidin/streptavidin conjugates, replacing the need for radioactive labeling.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.