Migration Assay: Cells expressing recombinant CCR7 were assayed for migration through a transwell filter at various concentrations of WT or Biotinylated MIP-3β. Responses are expressed as the % of total input cells (Blue: wild type; Red: biotinylated).

Biotinylated Macrophage inflammatory protein-3-beta (MIP-3B/CCL19) 8022

Price range: $134.00 through $2,862.00

Summary

Expression: E.coli
Amino Acid Range: 22-98

available size

Clear

SKU: 8022parent Categories: chemokine, proteins Tag: CCL19 (MIP-3B)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
accession	P99731
express system	E.coli
product tag	biotin at C-terminal
purity	> 97% by SDS PAGE
molecular weight	Predicted Molecular Mass: 11,218.9807 Da Extinction Coefficient: 14,180 M-1 cm-1 Actual Molecular Mass: 11,218.9807 Da by ESI Mass Spec
available size	10 µg, 100 µg, 2 µg, 50 µg
endotoxin	<0.01 EU per 1μg of the protein by the LAL method

Biotinylated Macrophage inflammatory protein-3-beta (MIP-3B/CCL19) 8022

antibody
Database link: human P99731
Size and concentration 2, 10, 50, 100µg and lyophilized
Form Lyophilized
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp
Purity > 97% by SDS PAGE and HPLC

target relevance
Homo sapiens CCL19 C-C motif chemokine 19
Protein names C-C motif chemokine 19
Alternative names Beta-chemokine exodus-3, CK beta-11, Epstein-Barr virus-induced molecule 1 ligand chemokine, Macrophage inflammatory protein 3 beta, Small-inducible cytokine A19
Gene names CCL19
Protein family Belongs to the intercrine beta (chemokine CC) family
Function May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4
Subcellular location Secreted
Structure Interacts with TNFAIP6 (via Link domain)
Keywords 3D-structure, Chemotaxis, Cytokine, Direct protein sequencing, Disulfide bond, Inflammatory response, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAV VFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
UniProt accession: Q99731

Data

Migration Assay: Cells expressing recombinant CCR7 were assayed for migration through a transwell filter at various concentrations of WT or Biotinylated MIP-3b. Responses are expressed as the % of total input cells (Blue: wild type; Red: biotinylated).

FAQ & Publications

Frequently Asked Questions

What is the expression system used for producing Biotinylated Macrophage inflammatory protein-3-beta (MIP-3B/CCL19)?

The protein is expressed in Escherichia coli (E.coli).

How should Biotinylated MIP-3B/CCL19 be stored to maintain stability?

The lyophilized protein should be stored at -20 to -70 °C as supplied for up to 12 months. After reconstitution, it can be stored under sterile conditions at 2 to 8 °C for 1 month or at -20 to -70 °C for 3 months. Avoid repeated freeze-thaw cycles.

What is the purity and molecular weight of this biotinylated chemokine?

The protein has a purity greater than 97% as determined by SDS PAGE and HPLC. Its predicted and actual molecular mass is approximately 11,219 Da as confirmed by ESI Mass Spectrometry.

What are the biological functions and target receptor of MIP-3B/CCL19?

MIP-3B/CCL19 is a homeostatic chemokine involved in lymphocyte recirculation and homing, directing chemotaxis of dendritic cells and certain B- and T-lymphocytes. It specifically binds to the CCR7 receptor on target cells.

Is the protein supplied with any specific conjugation, and how is it recommended to prepare it for experiments?

Yes, the protein is biotinylated at the C-terminal. For reconstitution, it is recommended to spin the sample prior to reconstitution and prepare a concentration of 100 µg/mL in sterile water.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.