Migration Assay: Cells expressing recombinant CCR1 were assayed for migration through a transwell filter at various concentrations of MIP-1α. Responses are expressed as the % of total input cells.

Macrophage inflammatory proteins 1-a (MIP1a/CCL3) 6004

$61.00 – $2,189.00

Summary

Expression: E.coli
Amino Acid Range: 24-92

SKU: 6004parent Categories: chemokine, proteins Tag: CCL3 (MIP-1a)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
accession	P10147
express system	E.coli
product tag	none
purity	> 97% by SDS PAGE
molecular weight	Predicted Molecular Mass: 7.716 kDa Extinction Coefficient: 10,010 M-1 cm-1 Actual Molecular Mass (Mass Spec): 7.716 kDa by ESI Mass Spec
available size	10 µg, 100 µg, 1mg, 2 µg, 50 µg
endotoxin	<0.01 EU per 1μg of the protein by the LAL method
sequence	SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSE EWVQKYVSDLELSA

Macrophage inflammatory proteins 1-a (MIP1a/CCL3) 6004

protein
Database link: human P10147
Size and concentration 5, 20, 50, 100, 1000µg and lyophilized
Form Lyophilized
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer â€‹Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp
Purity > 97% by SDS PAGE and HPLC

target relevance
Macrophage inflammatory proteins 1-α (MIP1α)(CCL3) binds to cell surface receptors CCR1 and CCR5. It is proinflammatory, leading to chemotaxis and activation of immune cells. It also inhibits proliferation of hematopoietic stem cells. Moreover, by binding to one of the HIV coreceptors, CCR5, it suppresses HIV infection.
Protein names C-C motif chemokine 3 (G0/G1 switch regulatory protein 19-1) (Macrophage inflammatory protein 1-alpha) (MIP-1-alpha) (PAT 464.1) (SIS-beta) (Small-inducible cytokine A3) (Tonsillar lymphocyte LD78 alpha protein) [Cleaved into: MIP-1-alpha(4-69) (LD78-alpha(4-69))]
Gene names CCL3,CCL3 G0S19-1 MIP1A SCYA3
Protein family Intercrine beta (chemokine CC) family
Mass 10085Da
Function Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).
Subellular location Secreted.
Structure Self-associates. Also heterodimer of MIP-1-alpha(4-69) and MIP-1-beta(3-69) (PubMed:12070155). Interacts with CCR1 (PubMed:15905581).
Post-translational modification N-terminal processed form LD78-alpha(4-69) is produced by proteolytic cleavage after secretion from HTLV1-transformed T-cells.
Target Relevance information above includes information from UniProt accession: P10147
The UniProt Consortium

Data

Migration Assay: Cells expressing recombinant CCR1 were assayed for migration through a transwell filter at various concentrations of MIP-1a. Responses are expressed as the % of total input cells.

Publications

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from PubMed database provided by The United States National Library of Medicine at the National Institutes of Health.