Migration Assay: Cells expressing recombinant CCR1 were assayed for migration through a transwell filter at various concentrations of MIP-1α. Responses are expressed as the % of total input cells.

Macrophage inflammatory proteins 1-a (MIP1a/CCL3) 6004

Price range: $61.00 through $2,189.00

Summary

Expression: E.coli
Amino Acid Range: 24-92

available size

Clear

SKU: 6004parent Categories: chemokine, proteins Tag: CCL3 (MIP-1a)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
accession	P10147
express system	E.coli
product tag	none
purity	> 97% by SDS PAGE
molecular weight	Predicted Molecular Mass: 7.716 kDa Extinction Coefficient: 10,010 M-1 cm-1 Actual Molecular Mass (Mass Spec): 7.716 kDa by ESI Mass Spec
available size	100 µg, 1mg, 20 µg, 5 µg, 50 µg
endotoxin	<0.01 EU per 1μg of the protein by the LAL method
sequence	SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSE EWVQKYVSDLELSA

Macrophage inflammatory proteins 1-a (MIP1a/CCL3) 6004

antibody
Database link: human P10147
Size and concentration 5, 20, 50, 100, 1000µg and lyophilized
Form Lyophilized
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp
Purity > 97% by SDS PAGE and HPLC

target relevance
Homo sapiens CCL3 C-C motif chemokine 3
Protein names C-C motif chemokine 3
Alternative names G0/G1 switch regulatory protein 19-1, Macrophage inflammatory protein 1-alpha, PAT 464.1, SIS-beta, Small-inducible cytokine A3, Tonsillar lymphocyte LD78 alpha protein
Gene names CCL3
Protein family Belongs to the intercrine beta (chemokine CC) family
Function Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV)
Subcellular location Secreted
Structure Self-associates. Also heterodimer of MIP-1-alpha(4-69) and MIP-1-beta(3-69) (PubMed:12070155). Interacts with CCR1 (PubMed:15905581)
Post-translational modification N-terminal processed form LD78-alpha(4-69) is produced by proteolytic cleavage after secretion from HTLV1-transformed T-cells
Keywords 3D-structure, Chemotaxis, Cytokine, Direct protein sequencing, Disulfide bond, Inflammatory response, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
UniProt accession: P10147

Data

Migration Assay: Cells expressing recombinant CCR1 were assayed for migration through a transwell filter at various concentrations of MIP-1a. Responses are expressed as the % of total input cells.

FAQ & Publications

Frequently Asked Questions

What is the source of expression for the Macrophage Inflammatory Protein 1-alpha (MIP1a/CCL3) product?

The MIP1a/CCL3 protein is expressed in Escherichia coli (E. coli) expression system.

How should the MIP1a/CCL3 protein be stored to maintain stability?

Store the lyophilized protein at -20 to -70 °C for up to 12 months. After reconstitution, it can be kept sterile at 2 to 8 °C for 1 month or at -20 to -70 °C for 3 months. Avoid repeated freeze-thaw cycles.

What is the purity and molecular weight of the recombinant MIP1a/CCL3 protein?

The protein is purified to greater than 97% purity by SDS-PAGE and HPLC. The predicted and actual molecular mass is approximately 7.716 kDa as confirmed by ESI Mass Spectrometry.

What biological targets and functions are associated with MIP1a/CCL3?

MIP1a/CCL3 binds to cell surface receptors CCR1 and CCR5, acting as a proinflammatory chemokine that induces chemotaxis and immune cell activation. It also inhibits hematopoietic stem cell proliferation and suppresses HIV infection by binding to the HIV coreceptor CCR5.

In what forms and sizes is the MIP1a/CCL3 protein available for purchase?

The protein is available lyophilized in sizes of 5 µg, 20 µg, 50 µg, 100 µg, and 1 mg.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.