Weight | 1 lbs |
---|---|
Dimensions | 9 × 5 × 2 in |
host | rabbit |
isotype | IgG |
clonality | polyclonal |
concentration | 1 mg/mL |
applications | ELISA |
available sizes | 1 mg, 100 µg, 25 µg |
rabbit anti-GST polyclonal antibody 3104
$100.00 – $2,600.00
Antibody summary
- Rabbit polyclonal to GST
- Suitable for: ELISA
- Reacts with: tagged fusion proteins
- Isotype: IgG
- 100 µg, 25 µg, 1 mg
rabbit anti-GST polyclonal antibody 3104
antibody |
---|
Database link: GST tag P08515 Sequence- MSPILGYWKIKGLVQPTRLLLEYLEEKYEE HLYERDEGDKWRNKKFELGLEFPNLPYYID GDVKLTQSMAIIRYIADKHNMLGGCPKERA EISMLEGAVLDIRYGVSRIAYSKDFETLKV DFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFK KRIEAIPQIDKYLKSSKYIAWPLQGWQATF GGGDHPPKSD |
Tested applications ELISA |
Recommended dilutions user optimized |
Immunogen Highly purified Glutathione-S-transferase (GST) from Schistosoma japonicum |
Size and concentration 25, 100, 1000µg and 1 mg/mL |
Form liquid |
Storage Instructions 2-8°C |
Storage buffer PBS, pH 7.2, 0.09% NaN3 |
Purity affinity purified |
Clonality polyclonal |
Isotype IgG |
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
Isotype control Rabbit polyclonal - Isotype Control |
target relevance |
---|
GST can be used as a tag to aid in the expression and folding of fusion proteins. This antibody can be used to confirm expression and quantify the GST tagged recombinant proteins in Western blotting and for their purification/copurification. When imaging in situ, GST tagged proteins can be identified by this antibody when used in conjunction with a suitable secondary antibody. Click for more on: epitope tags and GST tag |
Biotechnology GST fusion proteins, referring to Glutathione S-transferase fusion proteins, have become invaluable tools in molecular biology and biotechnology. GST, an enzyme naturally present in cells, is fused with the protein of interest to facilitate recombinant protein production and purification. The GST tag not only enhances the solubility and stability of the target protein but also allows for easy isolation using affinity chromatography with glutathione-linked resin. The specific and high-affinity interaction between GST and glutathione simplifies the purification process, resulting in highly pure and functional fusion proteins. Moreover, GST fusion proteins are widely used in protein-protein interaction studies, as they can help identify binding partners and elucidate complex signaling pathways. Additionally, GST fusion proteins serve as efficient antigens for generating antibodies, enabling researchers to produce specific and high-quality antibodies for various applications. The versatility and ease of use of GST fusion proteins make them indispensable in a wide range of research endeavors, from understanding protein function to drug discovery and beyond. |
Data
Publications
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from PubMed database provided by The United States National Library of Medicine at the National Institutes of Health.There are 2 publications in our database for this antibody or clone. Here are the latest 5, for more click below.
pmid | title | authors | citation |
---|---|---|---|
26742850 | Rhizobiales-like Phosphatase 2 from Arabidopsis thaliana Is a Novel Phospho-tyrosine-specific Phospho-protein Phosphatase (PPP) Family Protein Phosphatase | Uhrig RG, Labandera AM, Muhammad J, Samuel M, Moorhead GB. | J Biol Chem. 2016 Mar 11;291(11):5926-5934. doi: 10.1074/jbc.M115.683656. Epub 2016 Jan 7. |
19889946 | Molecular complex of three testis-specific isozymes associated with the mouse sperm fibrous sheath: hexokinase 1, phosphofructokinase M, and glutathione S-transferase mu class 5 | Nakamura N, Mori C, Eddy EM. | Biol Reprod. 2010 Mar;82(3):504-15. doi: 10.1095/biolreprod.109.080580. Epub 2009 Nov 4. |
Protocols
relevant to this product |
---|
ELISA |
Documents
# | |||
---|---|---|---|
No results found |
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.