mouse anti-GST monoclonal antibody (GST.B6) 8446

Price range: $100.00 through $2,600.00

Antibody summary

Mouse monoclonal to GST
Suitable for: WB,ICC/IF,ELISA
Reacts with: tagged fusion proteins
Isotype: IgG2a
100 µg, 25 µg, 1 mg

available sizes

Clear

SKU: 8446parent Categories: antibody, epitope tag Tag: GST

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2a
clonality	monoclonal
concentration	1 mg/mL
applications	ELISA, ICC/IF, WB
reactivity	tagged fusion proteins
available sizes	1 mg, 100 µg, 25 µg

mouse anti-GST monoclonal antibody (GST.B6) 8446

antibody
Database link: GST tag P08515 Sequence- MSPILGYWKIKGLVQPTRLLLEYLEEKYEE HLYERDEGDKWRNKKFELGLEFPNLPYYID GDVKLTQSMAIIRYIADKHNMLGGCPKERA EISMLEGAVLDIRYGVSRIAYSKDFETLKV DFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFK KRIEAIPQIDKYLKSSKYIAWPLQGWQATF GGGDHPPKSD
Tested applications WB,ICC/IF,ELISA
Recommended dilutions WB: 1:1000-3000 ICC/IF: 1:500-2000
Immunogen Highly purified Glutathione-S-transferase (GST) from Schistosoma japonicum
Size and concentration 25, 100, 1000µg and 1 mg/mL
Form liquid
Storage Instructions -20°C for 2 years or more. °Centrifuge after first thaw to maximize product recovery. Aliquot to avoid repeated freeze-thaw cycles. Store aliquots at 4°C for several days to weeks.
Storage buffer PBS, pH 7.2, 0.05% NaN₃
Purity affinity purified
Clonality monoclonal
Isotype IgG2a
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monocolonal IgG2a - Isotype Control

target relevance
GST can be used as a tag to aid in the expression and folding of fusion proteins. This antibody can be used to confirm expression and quantify the GST tagged recombinant proteins in Western blotting and for their purification/copurification. When imaging in situ, GST tagged proteins can be identified by this antibody when used in conjunction with a suitable secondary antibody. Click for more on: epitope tags and GST tag
Protein names Glutathione S-transferase
Biotechnology GST fusion proteins, referring to Glutathione S-transferase fusion proteins, have become invaluable tools in molecular biology and biotechnology. GST, an enzyme naturally present in cells, is fused with the protein of interest to facilitate recombinant protein production and purification. The GST tag not only enhances the solubility and stability of the target protein but also allows for easy isolation using affinity chromatography with glutathione-linked resin. The specific and high-affinity interaction between GST and glutathione simplifies the purification process, resulting in highly pure and functional fusion proteins. Moreover, GST fusion proteins are widely used in protein-protein interaction studies, as they can help identify binding partners and elucidate complex signaling pathways. Additionally, GST fusion proteins serve as efficient antigens for generating antibodies, enabling researchers to produce specific and high-quality antibodies for various applications. The versatility and ease of use of GST fusion proteins make them indispensable in a wide range of research endeavors, from understanding protein function to drug discovery and beyond.

Data

1:5,000 (0.2µg/mL) Ab dilution probed against BL-21 bacteria lysate expressing the GST protein.

FAQ & Publications

Frequently Asked Questions

What applications has the mouse anti-GST monoclonal antibody (GST.B6) been validated for?

This antibody has been tested and validated for use in Western blotting (WB), immunocytochemistry/immunofluorescence (ICC/IF), and ELISA applications.

What is the recommended storage condition for maintaining the stability of this antibody?

The antibody should be stored at -20°C for up to two years or more. After the first thaw, centrifuge to maximize product recovery and aliquot to avoid repeated freeze-thaw cycles. Aliquots can be kept at 4°C for several days to weeks.

Which species does the mouse anti-GST monoclonal antibody specifically react with?

This antibody specifically reacts with GST-tagged fusion proteins, irrespective of the species of the fusion protein, as it targets the GST tag derived from Schistosoma japonicum.

What is the host species and clonality of this anti-GST antibody?

The antibody is a mouse monoclonal with an IgG2a isotype.

What is the concentration and available sizes for this antibody product?

The antibody is supplied at a concentration of 1 mg/mL and is available in sizes of 25 µg, 100 µg, and 1 mg.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.