Skip to content

Macrophage inflammatory protein-3-beta (MIP-3B/CCL19) 6009

$61.00$2,189.00

Summary

  • Expression: E.coli
  • Amino Acid Range: 22-98
SKU: 6009parent Categories: , Tag:
Weight1 lbs
Dimensions9 × 5 × 2 in
accession

P99731

express system

E.coli

product tag

none

purity

> 97% by SDS PAGE

molecular weight

Predicted Molecular Mass: 8.800 kDa Extinction Coefficient: 8,730 M-1 cm-1 Actual Molecular Mass: 8.800 kDa by ESI Mass Spec

available size

10 µg, 100 µg, 1mg, 2 µg, 50 µg

endotoxin

<0.01 EU per 1μg of the protein by the LAL method

sequence

GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

Macrophage inflammatory protein-3-beta (MIP-3B/CCL19) 6009

protein
Database link:
human P99731
Size and concentration
5, 20, 50, 100, 1000µg and lyophilized
Form
Lyophilized
Storage Instructions
Avoid repeated freeze-thaw cycles:
• 12 months from date of receipt, -20 to -70 °C as supplied.
• 1 month, 2 to 8 °C under sterile conditions after reconstitution.
• 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer
​Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water.
Shipping: Room Temp
Purity
> 97% by SDS PAGE and HPLC
target relevance
Macrophage inflammatory protein-3-beta (MIP3β) (CCL19), also known as EBI1 ligand chemokine (ELC), directs chemotaxis of dendritic cells, and certain B- and T- lymphocytes, but not monocytes or granulocytes. It is constituitively expressed in thymus and lymph nodes and binds specifically to target cells expressing the receptor CCR7. Being a homeostatic chemokine, its primary physiological role is considered to be in the normal recirculation and homing of lymphocyte. However, MIP-3&beta could also be proinflammatory, and is implicated in the post-HIV infection responses.
Protein names
C-C motif chemokine 19 (Beta-chemokine exodus-3) (CK beta-11) (Epstein-Barr virus-induced molecule 1 ligand chemokine) (EBI1 ligand chemokine) (ELC) (Macrophage inflammatory protein 3 beta) (MIP-3-beta) (Small-inducible cytokine A19)
Protein family
444
Function
May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Pathway
338
Subellular location
Secreted.
Tissues
Expressed at high levels in the lymph nodes, thymus and appendix. Intermediate levels seen in colon and trachea, while low levels found in spleen, small intestine, lung, kidney and stomach.
Structure
Interacts with TNFAIP6 (via Link domain).
Target Relevance information above includes information from UniProt accession: Q99731
The UniProt Consortium

Data

Migration Assay: Cells expressing recombinant CCR7 were assayed for migration through a transwell filter at various concentrations of MIP-3b. Responses are expressed as the % of total input cells.
Migration Assay: Cells expressing recombinant CCR7 were assayed for migration through a transwell filter at various concentrations of MIP-3b. Responses are expressed as the % of total input cells.

Publications

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from PubMed database provided by The United States National Library of Medicine at the National Institutes of Health.




pmidtitleauthorscitation

Protocols

relevant to this product
Migration assay

Documents

#
Please enter your product and batch number here to retrieve - product datasheet, SDS, and QC information.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.