Weight | 1 lbs |
---|---|
Dimensions | 9 × 5 × 2 in |
accession | P13236 |
express system | E.coli |
product tag | none |
purity | > 97% by SDS PAGE |
molecular weight | Predicted Molecular Mass: 7.818 kDa Extinction Coefficient: 12, 570 M-1 cm-1 Actual Molecular Mass (Mass Spec): 7.818 kDa by ESI Mass Spec |
available size | 100 µg, 1mg, 20 µg, 5 µg, 50 µg |
endotoxin | <0.01 EU per 1μg of the protein by the LAL method |
sequence | APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSES WVQEYVYDLELN |
Macrophage inflammatory proteins 1-B (MIP-1B/CCL4) 6005
$61.00 – $2,189.00
Summary
- Expression: E.coli
- Amino Acid Range: 24-92
Macrophage inflammatory proteins 1-B (MIP-1B/CCL4) 6005
protein |
---|
Database link: human P13236 |
Size and concentration 5, 20, 50, 100, 1000µg and lyophilized |
Form Lyophilized |
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution |
Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp |
Purity > 97% by SDS PAGE and HPLC |
target relevance |
---|
Monokine with inflammatory and chemokinetic properties binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B. |
Protein names C-C motif chemokine 4 (G-26 T-lymphocyte-secreted protein) (HC21) (Lymphocyte activation gene 1 protein) (LAG-1) (MIP-1-beta(1-69)) (Macrophage inflammatory protein 1-beta) (MIP-1-beta) (PAT 744) (Protein H400) (SIS-gamma) (Small-inducible cytokine A4) (T-cell activation protein 2) (ACT-2) [Cleaved into: MIP-1-beta(3-69)] |
Gene names CCL4,CCL4 LAG1 MIP1B SCYA4 |
Protein family Intercrine beta (chemokine CC) family |
Mass 10212Da |
Function Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B. |
Subellular location Secreted. |
Structure Homodimer and heterodimer of MIP-1-alpha(4-69) and MIP-1-beta(3-69). |
Post-translational modification N-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes. |
Target Relevance information above includes information from UniProt accession: P13236 |
The UniProt Consortium |
Data
Migration Assay: Cells expressing recombinant CCR5 were assayed for migration through a transwell filter at various concentrations of MIP-1b. Responses are expressed as the % of total input cells. |
Publications
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from PubMed database provided by The United States National Library of Medicine at the National Institutes of Health.pmid | title | authors | citation |
---|
Protocols
relevant to this product |
---|
Migration assay |
Documents
# | ||
---|---|---|
Please enter your product and batch number here to retrieve - product datasheet, SDS, and QC information. |
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.