Notice: Function _load_textdomain_just_in_time was called incorrectly. Translation loading for the woocommerce-services domain was triggered too early. This is usually an indicator for some code in the plugin or theme running too early. Translations should be loaded at the init action or later. Please see Debugging in WordPress for more information. (This message was added in version 6.7.0.) in /www/benchmarkantibodiescom_769/public/wp-includes/functions.php on line 6121

Notice: Function _load_textdomain_just_in_time was called incorrectly. Translation loading for the woocommerce-payments domain was triggered too early. This is usually an indicator for some code in the plugin or theme running too early. Translations should be loaded at the init action or later. Please see Debugging in WordPress for more information. (This message was added in version 6.7.0.) in /www/benchmarkantibodiescom_769/public/wp-includes/functions.php on line 6121
Macrophage inflammatory proteins 1-B (MIP-1B/CCL4) 6005 – benchmark antibodies Macrophage inflammatory proteins 1-B (MIP-1B/CCL4) 6005
Skip to content

Macrophage inflammatory proteins 1-B (MIP-1B/CCL4) 6005

$61.00$2,189.00

Summary

  • Expression: E.coli
  • Amino Acid Range: 24-92
SKU: 6005parent Categories: , Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
accession

P13236

express system

E.coli

product tag

none

purity

> 97% by SDS PAGE

molecular weight

Predicted Molecular Mass: 7.818 kDa Extinction Coefficient: 12, 570 M-1 cm-1 Actual Molecular Mass (Mass Spec): 7.818 kDa by ESI Mass Spec

available size

100 µg, 1mg, 20 µg, 5 µg, 50 µg

endotoxin

<0.01 EU per 1μg of the protein by the LAL method

sequence

APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSES WVQEYVYDLELN

Macrophage inflammatory proteins 1-B (MIP-1B/CCL4) 6005
protein
Database link:
human P13236
Size and concentration
5, 20, 50, 100, 1000µg and lyophilized
Form
Lyophilized
Storage Instructions
Avoid repeated freeze-thaw cycles:
• 12 months from date of receipt, -20 to -70 °C as supplied.
• 1 month, 2 to 8 °C under sterile conditions after reconstitution.
• 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer
?Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water.
Shipping: Room Temp
Purity
> 97% by SDS PAGE and HPLC
target relevance
Monokine with inflammatory and chemokinetic properties binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.
Protein names
C-C motif chemokine 4 (G-26 T-lymphocyte-secreted protein) (HC21) (Lymphocyte activation gene 1 protein) (LAG-1) (MIP-1-beta(1-69)) (Macrophage inflammatory protein 1-beta) (MIP-1-beta) (PAT 744) (Protein H400) (SIS-gamma) (Small-inducible cytokine A4) (T-cell activation protein 2) (ACT-2) [Cleaved into: MIP-1-beta(3-69)]
Gene names
CCL4,CCL4 LAG1 MIP1B SCYA4
Protein family
Intercrine beta (chemokine CC) family
Mass
10212Da
Function
Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.
Subellular location
Secreted.
Structure
Homodimer and heterodimer of MIP-1-alpha(4-69) and MIP-1-beta(3-69).
Post-translational modification
N-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes.
Target Relevance information above includes information from UniProt accession: P13236
The UniProt Consortium

Data

Migration Assay: Cells expressing recombinant CCR5 were assayed for migration through a transwell filter at various concentrations of MIP-1b. Responses are expressed as the % of total input cells.
Migration Assay: Cells expressing recombinant CCR5 were assayed for migration through a transwell filter at various concentrations of MIP-1b. Responses are expressed as the % of total input cells.

Publications

Publications

pmid title authors citation
We haven't added any publications to our database yet.
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from PubMed database provided by The United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Migration assay

Documents

#
Please enter your product and batch number here to retrieve product datasheet, SDS, and QC information.