| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| accession | P13236 |
| express system | E.coli |
| product tag | none |
| purity | > 97% by SDS PAGE |
| molecular weight | Predicted Molecular Mass: 7.818 kDa Extinction Coefficient: 12, 570 M-1 cm-1 Actual Molecular Mass (Mass Spec): 7.818 kDa by ESI Mass Spec |
| available size | 100 µg, 1mg, 20 µg, 5 µg, 50 µg |
| endotoxin | <0.01 EU per 1μg of the protein by the LAL method |
| sequence | APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSES WVQEYVYDLELN |
Macrophage inflammatory proteins 1-B (MIP-1B/CCL4) 6005
Price range: $61.00 through $2,189.00
Summary
- Expression: E.coli
- Amino Acid Range: 24-92
Macrophage inflammatory proteins 1-B (MIP-1B/CCL4) 6005
| protein |
|---|
| Database link: human P13236 |
| Size and concentration 5, 20, 50, 100, 1000µg and lyophilized |
| Form Lyophilized |
| Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution |
| Storage buffer ​Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp |
| Purity > 97% by SDS PAGE and HPLC |
| target relevance |
|---|
| Monokine with inflammatory and chemokinetic properties binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B. |
| Protein names C-C motif chemokine 4 (G-26 T-lymphocyte-secreted protein) (HC21) (Lymphocyte activation gene 1 protein) (LAG-1) (MIP-1-beta(1-69)) (Macrophage inflammatory protein 1-beta) (MIP-1-beta) (PAT 744) (Protein H400) (SIS-gamma) (Small-inducible cytokine A4) (T-cell activation protein 2) (ACT-2) [Cleaved into: MIP-1-beta(3-69)] |
| Gene names CCL4,CCL4 LAG1 MIP1B SCYA4 |
| Protein family Intercrine beta (chemokine CC) family |
| Mass 10212Da |
| Function FUNCTION: Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B. {ECO:0000269|PubMed:10540332, ECO:0000269|PubMed:12070155, ECO:0000269|PubMed:8525373}. |
| Subellular location SUBCELLULAR LOCATION: Secreted. |
| Structure SUBUNIT: Homodimer and heterodimer of MIP-1-alpha(4-69) and MIP-1-beta(3-69). {ECO:0000269|PubMed:12070155}. |
| Post-translational modification PTM: N-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes. |
| Target Relevance information above includes information from UniProt accession: P13236 |
| The UniProt Consortium |
Data
![]() |
| Migration Assay: Cells expressing recombinant CCR5 were assayed for migration through a transwell filter at various concentrations of MIP-1b. Responses are expressed as the % of total input cells. |
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Protocols
| relevant to this product |
|---|
| Migration assay |
Documents
| # | ||
|---|---|---|
| Please enter your product and batch number here to retrieve product datasheet, SDS, and QC information. | ||
Only logged in customers who have purchased this product may leave a review.
















Reviews
There are no reviews yet.