Weight | 1 lbs |
---|---|
Dimensions | 9 × 5 × 2 in |
accession | P10147 |
express system | E.coli |
product tag | none |
purity | > 97% by SDS PAGE |
molecular weight | Predicted Molecular Mass: 7.716 kDa Extinction Coefficient: 10,010 M-1 cm-1 Actual Molecular Mass (Mass Spec): 7.716 kDa by ESI Mass Spec |
available size | 100 µg, 1mg, 20 µg, 5 µg, 50 µg |
endotoxin | <0.01 EU per 1μg of the protein by the LAL method |
sequence | SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSE EWV​QKYVSDLELSA |
Macrophage inflammatory proteins 1-a (MIP1a/CCL3) 6004
$61.00 – $2,189.00
Summary
- Expression: E.coli
- Amino Acid Range: 24-92
Macrophage inflammatory proteins 1-a (MIP1a/CCL3) 6004
protein |
---|
Database link: human P10147 |
Size and concentration 5, 20, 50, 100, 1000µg and lyophilized |
Form Lyophilized |
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution |
Storage buffer ​Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp |
Purity > 97% by SDS PAGE and HPLC |
target relevance |
---|
Macrophage inflammatory proteins 1-α (MIP1α)(CCL3) binds to cell surface receptors CCR1 and CCR5. It is proinflammatory, leading to chemotaxis and activation of immune cells. It also inhibits proliferation of hematopoietic stem cells. Moreover, by binding to one of the HIV coreceptors, CCR5, it suppresses HIV infection. |
Protein names C-C motif chemokine 3 (G0/G1 switch regulatory protein 19-1) (Macrophage inflammatory protein 1-alpha) (MIP-1-alpha) (PAT 464.1) (SIS-beta) (Small-inducible cytokine A3) (Tonsillar lymphocyte LD78 alpha protein) [Cleaved into: MIP-1-alpha(4-69) (LD78-alpha(4-69))] |
Gene names CCL3,CCL3 G0S19-1 MIP1A SCYA3 |
Protein family Intercrine beta (chemokine CC) family |
Mass 10085Da |
Function Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). |
Subellular location Secreted. |
Structure Self-associates. Also heterodimer of MIP-1-alpha(4-69) and MIP-1-beta(3-69) (PubMed:12070155). Interacts with CCR1 (PubMed:15905581). |
Post-translational modification N-terminal processed form LD78-alpha(4-69) is produced by proteolytic cleavage after secretion from HTLV1-transformed T-cells. |
Target Relevance information above includes information from UniProt accession: P10147 |
The UniProt Consortium |
Data
![]() |
Migration Assay: Cells expressing recombinant CCR1 were assayed for migration through a transwell filter at various concentrations of MIP-1a. Responses are expressed as the % of total input cells. |
Publications
Publications
pmid | title | authors | citation |
---|---|---|---|
We haven't added any publications to our database yet. |
Protocols
relevant to this product |
---|
Migration assay |
Documents
# | ||
---|---|---|
Please enter your product and batch number here to retrieve product datasheet, SDS, and QC information. |