Weight | 1 lbs |
---|---|
Dimensions | 9 × 5 × 2 in |
accession | Q16627 |
express system | E.coli |
product tag | none |
purity | > 97% by SDS PAGE |
molecular weight | Predicted Molecular Mass: 7.801 kDa Extinction Coefficient: 13,850 M-1 cm-1 Actual Molecular Mass: 7.801 kDa by ESI Mass Spec |
available size | 10 µg, 100 µg, 1mg, 2 µg, 50 µg |
endotoxin | <0.01 EU per 1μg of the protein by the LAL method |
sequence | GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKR GHSVCTN PSDKWVQDYIKDMKEN |
Hemofiltrate CC chemokine-1 (HCC-1/CCL14) 6008
$61.00 – $2,189.00
Summary
- Expression: E.coli
- Amino Acid Range: 28-93
Hemofiltrate CC chemokine-1 (HCC-1/CCL14)&
protein |
---|
Database link: human Q16627 |
Size and concentration 5, 20, 50, 100, 1000µg and lyophilized |
Form Lyophilized |
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution |
Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp |
Purity > 97% by SDS PAGE and HPLC |
target relevance |
---|
Hemofiltrate CC chemokine-1(HCC-1/CCL14) is endogeneously expressed by numerous tissues. Upon processing of the N terminal residues of the full length HCC-1 by the uPA-plasmin system, the active form of HCC-1 is a strong agonist for CCR1, CCR5 and to a lesser extent CCR3, and causes chemotaxis of different types of leukocytes. The active form of HCC-1 is also shown as a potent inhibitor of HIV entry. |
Protein names C-C motif chemokine 14 (Chemokine CC-1/CC-3) (HCC-1/HCC-3) (HCC-1(1-74)) (NCC-2) (Small-inducible cytokine A14) [Cleaved into: HCC-1(3-74); HCC-1(4-74); HCC-1(9-74)] |
Gene names CCL14,CCL14 NCC2 SCYA14 |
Protein family Intercrine beta (chemokine CC) family |
Mass 10678Da |
Function Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induces intracellular Ca(2+) changes and enzyme release, but no chemotaxis, at concentrations of 100-1,000 nM, and is inactive on T-lymphocytes, neutrophils, and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1(9-74) is a chemotactic factor that attracts monocytes, eosinophils, and T-cells and is a ligand for CCR1, CCR3 and CCR5. |
Subellular location Secreted. |
Tissues Expressed constitutively in several normal tissues: spleen, liver, skeletal and heart muscle, gut, and bone marrow, present at high concentrations (1-80 nM) in plasma. |
Post-translational modification The N-terminal processed forms HCC-1(3-74), HCC-1(4-74) and HCC-1(9-74) are produced in small amounts by proteolytic cleavage after secretion in blood.; HCC-1(1-74), but not HCC-1(3-74) and HCC-1(4-74), is partially O-glycosylated; the O-linked glycan consists of one Gal-GalNAc disaccharide, further modified by two N-acetylneuraminic acids. |
Target Relevance information above includes information from UniProt accession: Q16627 |
The UniProt Consortium |
Data
Migration Assay: Cells expressing recombinant CCR1 were assayed for migration through a transwell filter at various concentrations of HCC-1. Responses are expressed as the % of total input cells. |
Publications
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from PubMed database provided by The United States National Library of Medicine at the National Institutes of Health.pmid | title | authors | citation |
---|
Protocols
relevant to this product |
---|
Migration assay |
Documents
# | ||
---|---|---|
Please enter your product and batch number here to retrieve - product datasheet, SDS, and QC information. |
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.