Skip to content

Biotinylated Human CCL2 (MCP-1) 6003

Price range: $134.00 through $3,368.00

Summary

  • Expression: E.coli
  • Amino Acid Range: 24-99
SKU: 6003parent Categories: , Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
accession

P13500

express system

E.coli

product tag

biotin at C-terminal​

purity

> 97% by SDS PAGE

molecular weight

Predicted Molecular Mass: 11.085 kDa Extinction Coefficient: 14,180 M-1 cm-1 Actual Molecular Mass: 11.085 kDa by ESI MS

available size

10 µg, 100 µg, 2 µg, 50 µg

endotoxin

<0.01 EU per 1μg of the protein by the LAL method

Biotinylated Human CCL2 (MCP-1) 6003

antibody
Database link:
human P13500
Size and concentration
2, 10, 50, 100µg and lyophilized
Form
Lyophilized
Storage Instructions
Avoid repeated freeze-thaw cycles:
• 12 months from date of receipt, -20 to -70 °C as supplied.
• 1 month, 2 to 8 °C under sterile conditions after reconstitution.
• 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer
Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water.
Shipping: Room Temp
Purity
> 97% by SDS PAGE and HPLC
target relevance
Homo sapiens CCL2
C-C motif chemokine 2
Protein names
C-C motif chemokine 2
Alternative names
HC11, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, Monocyte chemotactic protein 1, Monocyte secretory protein JE, Small-inducible cytokine A2
Gene names
CCL2
Protein family
Belongs to the intercrine beta (chemokine CC) family
Function
Acts as a ligand for C-C chemokine receptor CCR2 (PubMed:10529171, PubMed:10587439, PubMed:9837883). Signals through binding and activation of CCR2 and induces a strong chemotactic response and mobilization of intracellular calcium ions (PubMed:10587439, PubMed:9837883). Exhibits a chemotactic activity for monocytes and basophils but not neutrophils or eosinophils (PubMed:8195247, PubMed:8627182, PubMed:9792674). May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis (PubMed:8107690)
Subcellular location
Secreted
Structure
Monomer or homodimer; in equilibrium (PubMed:15033992, PubMed:8898111, PubMed:8989326, PubMed:9837883). Is tethered on endothelial cells by glycosaminoglycan (GAG) side chains of proteoglycans (PubMed:9792674). Interacts with TNFAIP6 (via Link domain)
Post-translational modification
Processing at the N-terminus can regulate receptor and target cell selectivity (PubMed:8627182). Deletion of the N-terminal residue converts it from an activator of basophil to an eosinophil chemoattractant (PubMed:8627182)
N-Glycosylated
Keywords
3D-structure, Chemotaxis, Cytokine, Direct protein sequencing, Disulfide bond, Glycoprotein, Inflammatory response, Proteomics identification, Pyrrolidone carboxylic acid, Reference proteome, Secreted, Signal
Sequence
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
UniProt accession: P13500

Data

No results found

FAQ & Publications

Frequently Asked Questions
What is the expression system used for Biotinylated Human CCL2 (MCP-1) 6003?
Biotinylated Human CCL2 (MCP-1) 6003 is expressed in Escherichia coli (E.coli).
How should Biotinylated Human CCL2 (MCP-1) be stored after reconstitution?
After reconstitution, the protein can be stored for 1 month at 2 to 8 °C under sterile conditions or for 3 months at -20 to -70 °C under sterile conditions. Avoid repeated freeze-thaw cycles.
What is the purity level of this Biotinylated Human CCL2 (MCP-1) product?
The product has a purity greater than 97% as determined by SDS PAGE and HPLC analysis.
What is the advantage of enzymatic biotinylation used in this Biotinylated Human CCL2 (MCP-1)?
Enzymatic biotinylation attaches biotin at a specific lysine residue within the C-terminal avi tag sequence with nearly 100% completeness, maintaining functionalities comparable to unmodified CCL2 in migration assays and enabling effective use in receptor identification and cellular assays.
What are the available sizes for Biotinylated Human CCL2 (MCP-1) 6003 and its recommended reconstitution concentration?
The product is available in sizes of 2 µg, 10 µg, 50 µg, and 100 µg. It is recommended to reconstitute at a concentration of 100 µg/mL in sterile water after spinning the sample prior to reconstitution.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Migration assay

Documents

#
Please enter your product and batch number here.

 

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.