Migration Assay: Cells expressing recombinant CCR10 were assayed for migration through a transwell filter at various concentrations of MEC. Responses are expressed as the % of total input cells.

Mucosae-associated epithelial chemokine (MEC/CCL28) 8012

Price range: $61.00 through $2,189.00

Summary

Expression: E.coli
Amino Acid Range: 23-127

available size

Clear

SKU: 8012parent Categories: chemokine, proteins Tag: CCL28 (MEC)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
accession	Q9NRJ3
express system	E.coli
product tag	none
purity	> 97% by SDS PAGE
molecular weight	Predicted Molecular Mass: 12.031 kDa Extinction Coefficient: 8,970 M-1 cm-1 Actual Molecular Mass: 12.031kDa by ESI Mass Spec
available size	100 µg, 1mg, 20 µg, 5 µg, 50 µg
endotoxin	<0.01 EU per 1μg of the protein by the LAL method
sequence	ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVK QWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY

Mucosae-associated epithelial chemokine (MEC/CCL28) 8012

antibody
Database link: human Q9NRJ3
Size and concentration 5, 20, 50, 100, 1000µg and lyophilized
Form Lyophilized
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp
Purity > 97% by SDS PAGE and HPLC

target relevance
Homo sapiens CCL28 C-C motif chemokine 28
Protein names C-C motif chemokine 28
Alternative names Mucosae-associated epithelial chemokine, Protein CCK1, Small-inducible cytokine A28
Gene names CCL28
Protein family Belongs to the intercrine beta (chemokine CC) family
Function Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner
Subcellular location Secreted
Keywords 3D-structure, Alternative splicing, Chemotaxis, Cytokine, Disulfide bond, Glycoprotein, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDL AAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHET YGHKTPY
UniProt accession: Q9NRJ3

Data

Migration Assay: Cells expressing recombinant CCR10 were assayed for migration through a transwell filter at various concentrations of MEC. Responses are expressed as the % of total input cells.

FAQ & Publications

Frequently Asked Questions

What is the expression system used for producing Mucosae-associated epithelial chemokine (MEC/CCL28) 8012?

The MEC/CCL28 protein is expressed in Escherichia coli (E.coli).

How should Mucosae-associated epithelial chemokine (MEC/CCL28) 8012 be stored to maintain stability?

The lyophilized protein should be stored at -20 to -70 °C and is stable for 12 months from the date of receipt. After reconstitution, it can be stored for 1 month at 2 to 8 °C under sterile conditions or for 3 months at -20 to -70 °C under sterile conditions. Repeated freeze-thaw cycles should be avoided.

What is the purity level and molecular weight of the MEC/CCL28 protein provided?

The protein has a purity greater than 97% as assessed by SDS-PAGE and HPLC, with an actual molecular mass of approximately 12.031 kDa confirmed by ESI Mass Spectrometry.

What biological function does the Mucosae-associated epithelial chemokine (MEC/CCL28) serve?

MEC/CCL28 exhibits chemotactic activity for resting CD4 and CD8 T-cells as well as eosinophils by binding to CCR3 and CCR10 receptors, inducing calcium mobilization. It is also known for broad-spectrum antibacterial activity and potential use in HIV vaccination strategies.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.