Skip to content

Stromal-Cell Derived Factor-1a (SDF-1a/CXCL12) 8015

$61.00$2,189.00

Summary

  • Expression: E.coli
  • Amino Acid Range: 22-89
SKU: 8015parent Categories: , Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
accession

P48061-2

express system

E.coli

product tag

none

purity

> 97% by SDS PAGE

molecular weight

Predicted Molecular Mass: 7.963 kDa Extinction Coefficient: 8,730 M-1 cm-1 Actual Molecular Mass: 7.98 kDa by ESI Mass Spec

available size

100 µg, 1mg, 20 µg, 5 µg, 50 µg

endotoxin

<0.01 EU per 1μg of the protein by the LAL method

sequence

KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKL ​KWIQEYLEKALNK

Stromal-Cell Derived Factor-1a (SDF-1a/CXCL12) 8015

protein
Database link:
human P48061-2
Size and concentration
5, 20, 50, 100, 1000µg and lyophilized
Form
Lyophilized
Storage Instructions
Avoid repeated freeze-thaw cycles:
• 12 months from date of receipt, -20 to -70 °C as supplied.
• 1 month, 2 to 8 °C under sterile conditions after reconstitution.
• 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer
​Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water.
Shipping: Room Temp
Purity
> 97% by SDS PAGE and HPLC
target relevance
Stromal-Cell Derived Factor-1α (SDF-1alpha;) (CXCL12) attracts lymphocytes and plays important roles in embryogenesis and angiogenesis with implications in tumor metastasis. By binding to CXCR4, one of the co-receptors for HIV viral entry, SDF-1alpha; can suppress HIV. Besides CXCR4, SDF-1alpha; also binds to the 'decoy' receptor CXCR7, and activates the downstream β-arrestin- rather than G protein-mediated signaling pathway.
Protein names
Stromal cell-derived factor 1 (SDF-1) (hSDF-1) (C-X-C motif chemokine 12) (Intercrine reduced in hepatomas) (IRH) (hIRH) (Pre-B cell growth-stimulating factor) (PBSF) [Cleaved into: SDF-1-beta(3-72); SDF-1-alpha(3-67)]
Gene names
CXCL12,CXCL12 SDF1 SDF1A SDF1B
Protein family
Intercrine alpha (chemokine CxC) family
Mass
10666Da
Function
FUNCTION: Chemoattractant active on T-lymphocytes and monocytes but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. SDF-1-beta(3-72) and SDF-1-alpha(3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites. Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. Binds to the allosteric site (site 2) of integrins and activates integrins ITGAV:ITGB3, ITGA4:ITGB1 and ITGA5:ITGB1 in a CXCR4-independent manner (PubMed:29301984). Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. Stimulates the proliferation of bone marrow-derived B-cell progenitors in the presence of IL7 as well as growth of stromal cell-dependent pre-B-cells (By similarity). {ECO:0000250|UniProtKB:P40224, ECO:0000269|PubMed:11069075, ECO:0000269|PubMed:11859124, ECO:0000269|PubMed:16107333, ECO:0000269|PubMed:18802065, ECO:0000269|PubMed:19255243, ECO:0000269|PubMed:29301984, ECO:0000269|PubMed:8752281}.
Subellular location
SUBCELLULAR LOCATION: Secreted.
Tissues
TISSUE SPECIFICITY: Isoform Alpha and isoform Beta are ubiquitously expressed, with highest levels detected in liver, pancreas and spleen. Isoform Gamma is mainly expressed in heart, with weak expression detected in several other tissues. Isoform Delta, isoform Epsilon and isoform Theta have highest expression levels in pancreas, with lower levels detected in heart, kidney, liver and spleen. {ECO:0000269|PubMed:16626895}.
Structure
SUBUNIT: Monomer or homodimer; in equilibrium. Dimer formation is induced by non acidic pH and the presence of multivalent anions, and by binding to CXCR4 or heparin. Monomeric form is required for full chemotactic activity and resistance to ischemia/reperfusion injury, whereas the dimeric form acts as a partial agonist of CXCR4, stimulating Ca2+ mobilization but with no chemotactic activity and instead acts as a selective antagonist that blocks chemotaxis induced by the monomeric form. Interacts with the N-terminus of ACKR3. Interacts with integrin subunit ITGB3 (via the allosteric site (site 2)) (PubMed:29301984). Interacts with TNFAIP6 (via Link domain). {ECO:0000269|PubMed:10446158, ECO:0000269|PubMed:16107333, ECO:0000269|PubMed:16725153, ECO:0000269|PubMed:17264079, ECO:0000269|PubMed:18799424, ECO:0000269|PubMed:19255243, ECO:0000269|PubMed:27044744, ECO:0000269|PubMed:29301984, ECO:0000269|PubMed:9427609}.; SUBUNIT: (Microbial infection) Interacts with molluscum contagiosum virus protein MC148. {ECO:0000269|PubMed:21802105}.
Post-translational modification
PTM: Processed forms SDF-1-beta(3-72) and SDF-1-alpha(3-67) are produced after secretion by proteolytic cleavage of isoforms Beta and Alpha, respectively. The N-terminal processing is probably achieved by DPP4. Isoform Alpha is first cleaved at the C-terminus to yield a SDF-1-alpha(1-67) intermediate before being processed at the N-terminus. The C-terminal processing of isoform Alpha is reduced by binding to heparin and, probably, cell surface proteoglycans. {ECO:0000269|PubMed:14525775}.
Target Relevance information above includes information from UniProt accession: P48061
The UniProt Consortium

Data

Migration Assay: Jurkat cells expressing endogenous CXCR4 were assayed for migration through a transwell filter at various concentrations of WT SDF-1a. Responses are expressed as the % of total input cells
Migration Assay: Jurkat cells expressing endogenous CXCR4 were assayed for migration through a transwell filter at various concentrations of WT SDF-1a. Responses are expressed as the % of total input cells

Publications

Publications

pmid title authors citation
We haven't added any publications to our database yet.
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from PubMed database provided by The United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Migration assay

Documents

#
Please enter your product and batch number here to retrieve product datasheet, SDS, and QC information.