Migration Assay: Cells expressing recombinant CCR5 were assayed for migration through a transwell filter at various concentrations of Rantes. Responses are expressed as the % of total input cells.

Human CCL5 (Rantes) 6006

Price range: $61.00 through $2,189.00

Summary

Expression: E.coli
Amino Acid Range: 24-91

available size

Clear

SKU: 6006parent Categories: chemokine, proteins Tag: CCL5 (Rantes)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
accession	P13501
express system	E.coli
product tag	none
purity	> 97% by SDS PAGE
molecular weight	Predicted Molecular Mass: 7.851 kDa Extinction Coefficient: 12,570 M-1 cm-1 Actual Molecular Mass: 7.851 kDa by ESI Mass Spe
available size	100 µg, 1mg, 20 µg, 5 µg, 50 µg
endotoxin	<0.01 EU per 1μg of the protein by the LAL method
sequence	SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWV REYINSLEMS

Human CCL5 (Rantes) 6006

antibody
Database link: human P13501
Size and concentration 5, 20, 50, 100, 1000µg and lyophilized
Form Lyophilized
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp
Purity > 97% by SDS PAGE and HPLC

target relevance
Homo sapiens CCL5 C-C motif chemokine 5
Protein names C-C motif chemokine 5
Alternative names EoCP, Eosinophil chemotactic cytokine, SIS-delta, Small-inducible cytokine A5, T cell-specific protein P228, T-cell-specific protein RANTES
Gene names CCL5
Protein family Belongs to the intercrine beta (chemokine CC) family
Function Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) (PubMed:1380064, PubMed:15923218, PubMed:16791620, PubMed:8525373, PubMed:9516414). May also be an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization through its activation. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells (PubMed:23979485)
Subcellular location Secreted
Structure Homo and heterooligomers with other chemokines. Interacts with the brown dog tick evasin-4
Post-translational modification N-terminal processed form RANTES(3-68) is produced by proteolytic cleavage, probably by DPP4, after secretion from peripheral blood leukocytes and cultured sarcoma cells N-terminal processed form RANTES(4-68) is produced by proteolytic cleavage by cathepsin CTSG The identity of the O-linked saccharides at Ser-27 and Ser-28 are not reported in PubMed:1380064. They are assigned by similarity
Keywords 3D-structure, Chemotaxis, Cytokine, Direct protein sequencing, Disulfide bond, Glycoprotein, Inflammatory response, Oxidation, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP AVVFVTRKNRQVCANPEKKWVREYINSLEMS
UniProt accession: P13501

Data

Migration Assay: Cells expressing recombinant CCR5 were assayed for migration through a transwell filter at various concentrations of Rantes. Responses are expressed as the % of total input cells.

FAQ & Publications

Frequently Asked Questions

What are the recommended storage conditions for the Human CCL5 (Rantes) 6006 protein after reconstitution?

After reconstitution, the Human CCL5 (Rantes) 6006 protein should be stored under sterile conditions. It can be kept for 1 month at 2 to 8 °C or for 3 months at -20 to -70 °C. It is advised to avoid repeated freeze-thaw cycles to maintain protein stability.

What is the source and purity of the Human CCL5 (Rantes) 6006 protein provided?

The Human CCL5 (Rantes) 6006 protein is expressed in E. coli and supplied as a lyophilized powder. It has a purity of greater than 97% as determined by SDS-PAGE and HPLC analysis.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.