Skip to content

Human CCL5 (Rantes) 6006

Price range: $61.00 through $2,189.00

Summary

  • Expression: E.coli
  • Amino Acid Range: 24-91
SKU: 6006parent Categories: , Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
accession

P13501

express system

E.coli

product tag

none

purity

> 97% by SDS PAGE

molecular weight

Predicted Molecular Mass: 7.851 kDa Extinction Coefficient: 12,570 M-1 cm-1 Actual Molecular Mass: 7.851 kDa by ESI Mass Spe

available size

100 µg, 1mg, 20 µg, 5 µg, 50 µg

endotoxin

<0.01 EU per 1μg of the protein by the LAL method

sequence

SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWV REYINSLEMS

Human CCL5 (Rantes) 6006

protein
Database link:
human P13501
Size and concentration
5, 20, 50, 100, 1000µg and lyophilized
Form
Lyophilized
Storage Instructions
Avoid repeated freeze-thaw cycles:
• 12 months from date of receipt, -20 to -70 °C as supplied.
• 1 month, 2 to 8 °C under sterile conditions after reconstitution.
• 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer
​Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water.
Shipping: Room Temp
Purity
> 97% by SDS PAGE and HPLC
target relevance
Regulated on Activation, Normal T cell Expressed and Secreted (RANTES) (CCL5) is a proinflammatory chemokine that induces migration and activation of leukocytes, as well as implication in HIV infection. It binds to cell surface receptors CCR1, CCR3, CCR4, and CCR5. Its biological effects on leukocyte activation and HIV infection displays dependence on concentration and on the binding of cell surface glycosaminoglycans.
Protein names
C-C motif chemokine 5 (EoCP) (Eosinophil chemotactic cytokine) (SIS-delta) (Small-inducible cytokine A5) (T cell-specific protein P228) (TCP228) (T-cell-specific protein RANTES) [Cleaved into: RANTES(3-68); RANTES(4-68)]
Gene names
CCL5,CCL5 D17S136E SCYA5
Protein family
Intercrine beta (chemokine CC) family
Mass
9990Da
Function
FUNCTION: Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) (PubMed:1380064, PubMed:15923218, PubMed:16791620, PubMed:8525373, PubMed:9516414). May also be an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization through its activation. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells (PubMed:23979485). {ECO:0000269|PubMed:1380064, ECO:0000269|PubMed:15923218, ECO:0000269|PubMed:16791620, ECO:0000269|PubMed:17001303, ECO:0000269|PubMed:23979485, ECO:0000269|PubMed:8525373, ECO:0000269|PubMed:9516414}.
Subellular location
SUBCELLULAR LOCATION: Secreted.
Tissues
TISSUE SPECIFICITY: Expressed in the follicular fluid (at protein level). T-cell and macrophage specific. {ECO:0000269|PubMed:23765988, ECO:0000269|PubMed:2456327}.
Structure
SUBUNIT: Homo and heterooligomers with other chemokines. Interacts with the brown dog tick evasin-4. {ECO:0000269|PubMed:32817341}.
Post-translational modification
PTM: N-terminal processed form RANTES(3-68) is produced by proteolytic cleavage, probably by DPP4, after secretion from peripheral blood leukocytes and cultured sarcoma cells. {ECO:0000269|PubMed:9516414}.; PTM: N-terminal processed form RANTES(4-68) is produced by proteolytic cleavage by cathepsin CTSG. {ECO:0000269|PubMed:16963625}.; PTM: The identity of the O-linked saccharides at Ser-27 and Ser-28 are not reported in PubMed:1380064. They are assigned by similarity. {ECO:0000269|PubMed:1380064}.
Target Relevance information above includes information from UniProt accession: P13501
The UniProt Consortium

Data

Migration Assay: Cells expressing recombinant CCR5 were assayed for migration through a transwell filter at various concentrations of Rantes. Responses are expressed as the % of total input cells.
Migration Assay: Cells expressing recombinant CCR5 were assayed for migration through a transwell filter at various concentrations of Rantes. Responses are expressed as the % of total input cells.

Publications

pmid title authors citation
We haven't added any publications to our database yet.
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Migration assay

Documents

#
Please enter your product and batch number here to retrieve product datasheet, SDS, and QC information.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.