Migration Assay: Cells expressing recombinant CCR2 were assayed for migration through a transwell filter at various concentrations of MCP-3. Responses are expressed as the % of total input cells.

Monocyte chemotactic protein 3 (MCP-3/CCL7) 6007

Price range: $61.00 through $2,189.00

Summary

Expression: E.coli
Amino Acid Range: 24-99

available size

Clear

SKU: 6007parent Categories: chemokine, proteins Tag: CCL7 (MCP-3)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
accession	P80098
express system	E.coli
product tag	none
purity	> 97% by SDS PAGE
molecular weight	Predicted Molecular Mass: 8.956 kDa Extinction Coefficient: 8,730 M-1 cm-1 Actual Molecular Mass: 8.956 kDa by ESI Mass Spec
available size	100 µg, 1mg, 20 µg, 5 µg, 50 µg
endotoxin	<0.01 EU per 1μg of the protein by the LAL method
sequence	QPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCPREAVIFKTKLDKEICADPTQKWV QDFMKHLDKKTQTPKL

Monocyte chemotactic protein 3 (MCP-3/CCL7) 6007

antibody
Database link: human P80098
Size and concentration 5, 20, 50, 100, 1000µg and lyophilized
Form Lyophilized
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp
Purity > 97% by SDS PAGE and HPLC

target relevance
Homo sapiens CCL7 C-C motif chemokine 7
Protein names C-C motif chemokine 7
Alternative names Monocyte chemoattractant protein 3, Monocyte chemotactic protein 3, NC28, Small-inducible cytokine A7
Gene names CCL7
Protein family Belongs to the intercrine beta (chemokine CC) family
Function Chemotactic factor that plays an important role in immune regulation. Attracts monocytes, eosinophils, basophils, and T-cells to sites of inflammation or infection. Upon binding to various chemokine receptors including CCR1, CCR2, CCR3, and CCR5, facilitates immune cell migration by guiding them to infected tissues (PubMed:9364936, PubMed:10477718). Interacts with CCR2 to facilitate the release of monocytes from the bone marrow into the bloodstream, maintaining monocyte homeostasis. In turn, monocytes recruited to inflamed or injured tissues can differentiate into macrophages or dendritic cells, which are essential for immune defense and tissue repair. Through CCR1, contributes to macrophage polarization via NF-kappa-B activation which leads to the release of inflammatory factors (PubMed:38417634). In the trigeminal ganglion neurons, activates ERK via CCR2 and CCR3 to enhance neuronal excitability, which contributes to the maintenance of trigeminal neuropathic pain. Additionally, modulates the early immune response in the skin, preventing pathogen dissemination while maintaining cutaneous immune control
Subcellular location Secreted
Structure Monomer. Interacts with TNFAIP6 (via Link domain)
Post-translational modification O-glycosylated
Keywords 3D-structure, Chemotaxis, Cytokine, Direct protein sequencing, Disulfide bond, Glycoprotein, Heparin-binding, Inflammatory response, Proteomics identification, Pyrrolidone carboxylic acid, Reference proteome, Secreted, Signal
Sequence MKASAALLCLLLTAAAFSPQGLAQPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCP REAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL
UniProt accession: P80098

Data

Migration Assay: Cells expressing recombinant CCR2 were assayed for migration through a transwell filter at various concentrations of MCP-3. Responses are expressed as the % of total input cells.

FAQ & Publications

Frequently Asked Questions

What is the source organism for the recombinant MCP-3 (CCL7) protein provided in this product?

The MCP-3 (CCL7) protein is expressed in Escherichia coli (E.coli) as the recombinant expression system.

How should the lyophilized MCP-3 (CCL7) protein be stored to maintain stability?

The lyophilized protein should be stored at -20 to -70 °C for up to 12 months. After reconstitution, it can be kept at 2 to 8 °C under sterile conditions for 1 month, or at -20 to -70 °C for 3 months, avoiding repeated freeze-thaw cycles.

What is the purity level of the MCP-3 (CCL7) protein and how is it determined?

The protein purity is greater than 97%, as determined by SDS-PAGE and HPLC analysis.

What is the predicted molecular mass and extinction coefficient of the MCP-3 (CCL7) protein?

The predicted molecular mass of the MCP-3 (CCL7) protein is 8.956 kDa, and the extinction coefficient is 8,730 M-1 cm-1.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.