Migration Assay: Cells expressing recombinant CCR7 were assayed for migration through a transwell filter at various concentrations of MIP-3β. Responses are expressed as the % of total input cells.

Macrophage inflammatory protein-3-beta (MIP-3B/CCL19) 6009

Price range: $61.00 through $2,189.00

Summary

Expression: E.coli
Amino Acid Range: 22-98

available size

Clear

SKU: 6009parent Categories: chemokine, proteins Tag: CCL19 (MIP-3B)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
accession	P99731
express system	E.coli
product tag	none
purity	> 97% by SDS PAGE
molecular weight	Predicted Molecular Mass: 8.800 kDa Extinction Coefficient: 8,730 M-1 cm-1 Actual Molecular Mass: 8.800 kDa by ESI Mass Spec
available size	100 µg, 1mg, 20 µg, 5 µg, 50 µg
endotoxin	<0.01 EU per 1μg of the protein by the LAL method
sequence	GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

Macrophage inflammatory protein-3-beta (MIP-3B/CCL19) 6009

antibody
Database link: human P99731
Size and concentration 5, 20, 50, 100, 1000µg and lyophilized
Form Lyophilized
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp
Purity > 97% by SDS PAGE and HPLC

target relevance
Homo sapiens CCL19 C-C motif chemokine 19
Protein names C-C motif chemokine 19
Alternative names Beta-chemokine exodus-3, CK beta-11, Epstein-Barr virus-induced molecule 1 ligand chemokine, Macrophage inflammatory protein 3 beta, Small-inducible cytokine A19
Gene names CCL19
Protein family Belongs to the intercrine beta (chemokine CC) family
Function May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4
Subcellular location Secreted
Structure Interacts with TNFAIP6 (via Link domain)
Keywords 3D-structure, Chemotaxis, Cytokine, Direct protein sequencing, Disulfide bond, Inflammatory response, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAV VFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
UniProt accession: Q99731

Data

Migration Assay: Cells expressing recombinant CCR7 were assayed for migration through a transwell filter at various concentrations of MIP-3b. Responses are expressed as the % of total input cells.

FAQ & Publications

Frequently Asked Questions

What is the source and expression system for the Macrophage inflammatory protein-3-beta (MIP-3B/CCL19) protein?

The Macrophage inflammatory protein-3-beta (MIP-3B/CCL19) protein is expressed in Escherichia coli (E.coli).

How should I store the lyophilized MIP-3B/CCL19 protein to maintain its stability?

The lyophilized MIP-3B/CCL19 protein should be stored at -20 to -70 °C to ensure stability for up to 12 months from the date of receipt. After reconstitution, it can be stored for 1 month at 2 to 8 °C under sterile conditions or for 3 months at -20 to -70 °C under sterile conditions. Avoid repeated freeze-thaw cycles.

What is the purity and endotoxin level of this recombinant MIP-3B/CCL19 protein product?

This recombinant MIP-3B/CCL19 protein is purified to greater than 97% purity as determined by SDS-PAGE and HPLC analysis. The endotoxin level is less than 0.01 EU per 1 μg of protein as measured by the LAL method.

What is the molecular weight and amino acid range covered by this MIP-3B/CCL19 protein product?

The MIP-3B/CCL19 protein has a predicted and actual molecular mass of approximately 8.8 kDa, corresponding to the amino acid range from residues 22 to 98 of the full-length protein.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.