Migration Assay: Cells expressing recombinant CCR7 were assayed for migration through a transwell filter at various concentrations of MIP-3β. Responses are expressed as the % of total input cells.

Macrophage inflammatory protein-3-beta (MIP-3B/CCL19) 6009

$61.00 – $2,189.00

Summary

Expression: E.coli
Amino Acid Range: 22-98

SKU: 6009parent Categories: chemokine, proteins Tag: CCL19 (MIP-3B)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
accession	P99731
express system	E.coli
product tag	none
purity	> 97% by SDS PAGE
molecular weight	Predicted Molecular Mass: 8.800 kDa Extinction Coefficient: 8,730 M-1 cm-1 Actual Molecular Mass: 8.800 kDa by ESI Mass Spec
available size	100 µg, 1mg, 20 µg, 5 µg, 50 µg
endotoxin	<0.01 EU per 1μg of the protein by the LAL method
sequence	GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

Macrophage inflammatory protein-3-beta (MIP-3B/CCL19) 6009

protein
Database link: human P99731
Size and concentration 5, 20, 50, 100, 1000µg and lyophilized
Form Lyophilized
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp
Purity > 97% by SDS PAGE and HPLC

target relevance
Macrophage inflammatory protein-3-beta (MIP3β) (CCL19), also known as EBI1 ligand chemokine (ELC), directs chemotaxis of dendritic cells, and certain B- and T- lymphocytes, but not monocytes or granulocytes. It is constituitively expressed in thymus and lymph nodes and binds specifically to target cells expressing the receptor CCR7. Being a homeostatic chemokine, its primary physiological role is considered to be in the normal recirculation and homing of lymphocyte. However, MIP-3&beta could also be proinflammatory, and is implicated in the post-HIV infection responses.
Protein names C-C motif chemokine 19 (Beta-chemokine exodus-3) (CK beta-11) (Epstein-Barr virus-induced molecule 1 ligand chemokine) (EBI1 ligand chemokine) (ELC) (Macrophage inflammatory protein 3 beta) (MIP-3-beta) (Small-inducible cytokine A19)
Protein family 444
Function May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Pathway 338
Subellular location Secreted.
Tissues Expressed at high levels in the lymph nodes, thymus and appendix. Intermediate levels seen in colon and trachea, while low levels found in spleen, small intestine, lung, kidney and stomach.
Structure Interacts with TNFAIP6 (via Link domain).
Target Relevance information above includes information from UniProt accession: Q99731
The UniProt Consortium

Data

Migration Assay: Cells expressing recombinant CCR7 were assayed for migration through a transwell filter at various concentrations of MIP-3b. Responses are expressed as the % of total input cells.

Publications

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from PubMed database provided by The United States National Library of Medicine at the National Institutes of Health.