Migration Assay: Cells expressing recombinant CXCR3 were assayed for migration through a transwell filter at various concentrations of WT IP-10. Responses are expressed as the % of total input cells.

Interferon gamma-induced protein 10 (IP-10/CXCL10) 8014

Price range: $61.00 through $2,189.00

Summary

Expression: E.coli
Amino Acid Range: 22-98

available size

Clear

SKU: 8014parent Categories: chemokine, proteins Tag: CXCL10 (IP-10)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
accession	P02778
express system	E.coli
product tag	none
purity	> 97% by SDS PAGE
molecular weight	Actual Molecular Mass: 8.6 kDa by ESI Mass Spec Predicted Molecular Mass: 8.6 kDa Extinction Coefficient: 480 M-1 cm-1 (A280), 11 (mg/ml•cm)-1 (A220)
available size	100 µg, 1mg, 20 µg, 5 µg, 50 µg
endotoxin	<0.01 EU per 1μg of the protein by the LAL method
sequence	VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKERSKRSP

Interferon gamma-induced protein 10 (IP-10/CXCL10) 8014

protein
Database link: human P02778
Size and concentration 5, 20, 50, 100, 1000µg and lyophilized
Form Lyophilized
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer Ã¢â‚¬â€¹Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp
Purity > 97% by SDS PAGE and HPLC

target relevance
CXCL10 (IP-10) was originally identified as an IFN-gamma-inducible gene in endothelial, fibroblasts and monocytes cells. IP-10 is considered a member of the CXC chemokine subfamily from its protein sequence which includes the four conserved cysteine residues present in CXC chemokines. IP-10 signals through the CXCR3 receptor to selectively attract Th1 lymphocytes and monocytes. It also has angiostatic and mitogenic properties on vascular smooth muscle cells.
Protein names C-X-C motif chemokine 10 (10 kDa interferon gamma-induced protein) (Gamma-IP10) (IP-10) (Small-inducible cytokine B10) [Cleaved into: CXCL10(1-73)]
Gene names CXCL10,CXCL10 INP10 SCYB10
Protein family Intercrine alpha (chemokine CxC) family
Mass 10881Da
Function FUNCTION: Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects (PubMed:11157474, PubMed:22652417, PubMed:7540647). Plays thereby an important role during viral infections by stimulating the activation and migration of immune cells to the infected sites (By similarity). Mechanistically, binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling and results in downstream activation of phospholipase C-dependent pathway, an increase in intracellular calcium production and actin reorganization (PubMed:12750173, PubMed:19151743). In turn, recruitment of activated Th1 lymphocytes occurs at sites of inflammation (PubMed:12663757, PubMed:12750173). Activation of the CXCL10/CXCR3 axis also plays an important role in neurons in response to brain injury for activating microglia, the resident macrophage population of the central nervous system, and directing them to the lesion site. This recruitment is an essential element for neuronal reorganization (By similarity). {ECO:0000250\|UniProtKB:P17515, ECO:0000269\|PubMed:11157474, ECO:0000269\|PubMed:12663757, ECO:0000269\|PubMed:12750173, ECO:0000269\|PubMed:19151743, ECO:0000269\|PubMed:22652417, ECO:0000269\|PubMed:7540647}.
Subellular location SUBCELLULAR LOCATION: Secreted {ECO:0000269\|PubMed:21183794}.
Tissues TISSUE SPECIFICITY: Mainly secreted by monocytes, endothelial cells as well as fibroblasts. Expressed by epithelial cells in thymus (PubMed:11157474). Microglial cells produce CXCL10 in response to viral stimulation (PubMed:12663757). {ECO:0000269\|PubMed:11157474, ECO:0000269\|PubMed:12663757}.
Structure SUBUNIT: Monomer, dimer, and tetramer (PubMed:12737818). Interacts with CXCR3 (via N-terminus) (PubMed:19151743). {ECO:0000269\|PubMed:12737818, ECO:0000269\|PubMed:19151743}.
Post-translational modification PTM: Several proteases can mediate post-secretion cleavages. DPP4 cleaves CXCL10 on its N-terminal 2 amino acids leading to an antagonist form of CXCL10. This dominant negative form is capable of binding CXCR3 but does not induce signaling. MMP9 cleaves 9 amino acids instead. {ECO:0000269\|PubMed:21183794}.
Target Relevance information above includes information from UniProt accession: P02778
The UniProt Consortium

Data

Migration Assay: Cells expressing recombinant CXCR3 were assayed for migration through a transwell filter at various concentrations of WT IP-10. Responses are expressed as the % of total input cells.

FAQ & Publications

Frequently Asked Questions

What is the recommended storage protocol for Interferon gamma-induced protein 10 (IP-10/CXCL10) 8014 after reconstitution?

After reconstitution, it is recommended to store the protein under sterile conditions at 2 to 8 °C for up to 1 month, or at -20 to -70 °C for up to 3 months to maintain stability.

Which expression system is used for the production of the IP-10/CXCL10 8014 protein, and what is its purity?

The IP-10/CXCL10 8014 protein is expressed in Escherichia coli (E.coli) and has a purity greater than 97% as determined by SDS-PAGE and HPLC.

What is the biological role and receptor target of the IP-10/CXCL10 protein provided in this product?

IP-10/CXCL10 is a pro-inflammatory chemokine that signals through the CXCR3 receptor to selectively attract Th1 lymphocytes and monocytes. It plays important roles in chemotaxis, immune cell activation, modulation of angiostatic effects, and neuronal response to injury.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.