chicken anti-myc tag polyclonal antibody 5762

Price range: $100.00 through $2,600.00

Antibody summary

Chicken polyclonal to myc tag
Suitable for: ELISA
Reacts with: tagged fusion proteins
Isotype: IgY
100 µg, 25 µg, 1 mg

SKU: 5762parent Categories: antibody, epitope tag Tag: myc tag

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	chicken
isotype	IgY
clonality	polyclonal
concentration	1 mg/mL
applications	ELISA
reactivity	tagged fusion proteins
available sizes	1 mL, 100 µL, 25 µL

chicken anti-myc tag polyclonal antibody 5762

antibody
Database link: Sequence -Glu-Gln-Lys-Leu-Ile-Ser-Glu-Glu-Asp-Leu Derived from c-myc 425-434 P01106
Tested applications ELISA
Recommended dilutions user optimized
Application Notes Chickens were immunized with highly purified EQKLISEEDL (C-MYC) conjugated with KLH. Eggs were collected and an IgY enriched fraction was prepared. Antibody was solid phase adsorbed before immunoaffinity purified off a peptide containing immunosorbent. Antibody concentration was determined using an absorbance at 280 nm: 1.32 equals 1.0 mg of IgY.
Immunogen Highly purified EQKLISEEDL (C-MYC) conjugated with KLH
Size and concentration 25, 100, 1000µg and 1 mg/mL
Form liquid
Storage Instructions highly purified EQKLISEEDL (C-MYC) conjugated with KLH
Storage buffer PBS, pH 7.2, 0.09% NaN₃
Purity affinity purified
Clonality polyclonal
Isotype IgY
Compatible secondaries goat anti-chicken IgY, H&L chain specific, peroxidase conjugated polyclonal antibody 1688 goat anti-chicken IgY, H&L chain specific, biotin conjugated polyclonal antibody 8036 goat anti-chicken IgY, H&L chain specific, FITC conjugated, Conjugated polyclonal antibody 4317 goat anti-chicken IgY, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1708 goat anti-chicken IgY, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1718 goat anti-chicken IgY, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1723
Isotype control Chicken polyclonal - Isotype Control

target relevance
Homo sapiens MYC Myc proto-oncogene protein
Protein names Myc proto-oncogene protein
Alternative names Class E basic helix-loop-helix protein 39, Proto-oncogene c-Myc, Transcription factor p64
Gene names MYC
Function Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3' (PubMed:24940000, PubMed:25956029). Activates the transcription of growth-related genes (PubMed:24940000, PubMed:25956029). Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis (PubMed:24940000, PubMed:25956029). Regulator of somatic reprogramming, controls self-renewal of embryonic stem cells (By similarity). Functions with TAF6L to activate target gene expression through RNA polymerase II pause release (By similarity). Positively regulates transcription of HNRNPA1, HNRNPA2 and PTBP1 which in turn regulate splicing of pyruvate kinase PKM by binding repressively to sequences flanking PKM exon 9, inhibiting exon 9 inclusion and resulting in exon 10 inclusion and production of the PKM M2 isoform (PubMed:20010808)
Subcellular location Nucleus, nucleoplasm, Nucleus, nucleolus, Nucleus, Cytoplasm, Chromosome
Structure Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MAX (PubMed:9680483). Interacts with TAF1C and SPAG9. Interacts with PARP10. Interacts with KDM5A and KDM5B. Interacts (when phosphorylated at Thr-73 and Ser-77) with FBXW7 (PubMed:17558397, PubMed:25775507). Interacts with PIM2. Interacts with RIOX1. The heterodimer MYC:MAX interacts with ABI1; the interaction may enhance MYC:MAX transcriptional activity. Interacts with TRIM6 (By similarity). Interacts with NPM1; the binary complex is recruited to the promoter of MYC target genes and enhances their transcription (PubMed:25956029). Interacts with CIP2A; leading to the stabilization of MYC (PubMed:17632056). Interacts with NUP205 (PubMed:22719065). Interacts with HEATR1; the interaction is required for localization of MYC to the nucleolus (PubMed:38225354)
Post-translational modification Phosphorylated by PRKDC (PubMed:1597196). Phosphorylation at Ser-344 by PIM2 leads to the stabilization of MYC (By similarity). Phosphorylation at Ser-77 by CDK2 prevents Ras-induced senescence (PubMed:19966300, PubMed:20713526). Phosphorylated at Ser-77 by DYRK2; this primes the protein for subsequent phosphorylation by GSK3B at Thr-73 (PubMed:22307329). Phosphorylation at Thr-73 and Ser-77 by GSK3 is required for ubiquitination and degradation by the proteasome (PubMed:15103331, PubMed:17558397, PubMed:8386367). Dephosphorylation at multiple sites by the PNUTS-PP1 complex promotes MYC stability by preventing ubiquitination by the SCF(FBXW7) complex (PubMed:30158517). Dephosphorylation at Ser-77 by protein phosphatase 2A (PPP2CA) promotes its degradation; interaction with PPP2CA is enhanced by AMBRA1 (PubMed:25438055, PubMed:25803737) Ubiquitinated by the SCF(FBXW7) complex when phosphorylated at Thr-73 and Ser-77, leading to its degradation by the proteasome (PubMed:15103331, PubMed:17558397, PubMed:25775507, PubMed:30158517). In the nucleoplasm, ubiquitination is counteracted by USP28, which interacts with isoform 1 of FBXW7 (FBW7alpha), leading to its deubiquitination and preventing degradation (PubMed:17558397, PubMed:17873522). In the nucleolus, however, ubiquitination is not counteracted by USP28 but by USP36, due to the lack of interaction between isoform 3 of FBXW7 (FBW7gamma) and USP28, explaining the selective MYC degradation in the nucleolus (PubMed:17558397, PubMed:25775507). Also polyubiquitinated by the DCX(TRPC4AP) complex (PubMed:20551172, PubMed:29779948). Ubiquitinated by UBR5 when not forming a heterodimer with another bHLH protein, leading to its degradation: UBR5 recognizes and binds a degron that is only available upon heterodimer dissociation (PubMed:33208877, PubMed:37478862). Ubiquitinated by TRIM6 in a phosphorylation-independent manner (By similarity)
Involvement in disease Burkitt lymphoma A form of undifferentiated malignant lymphoma commonly manifested as a large osteolytic lesion in the jaw or as an abdominal mass.
Keywords 3D-structure, Acetylation, Activator, Alternative initiation, Alternative splicing, Chromosomal rearrangement, Chromosome, Cytoplasm, DNA-binding, Glycoprotein, Isopeptide bond, Nucleus, Phosphoprotein, Proteomics identification, Proto-oncogene, Reference proteome, Transcription, Transcription regulation, Ubl conjugation
Sequence MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTEL LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPA RGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP RSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
UniProt accession: P01106

Data

ELISA-image-chicken-anti-myc tag-polyclonal-antibody-5762

FAQ & Publications

Frequently Asked Questions

What applications is the chicken anti-myc tag polyclonal antibody 5762 validated for?

This antibody is validated for use in ELISA applications to detect tagged fusion proteins containing the myc tag.

What is the host species and clonality of the anti-myc tag antibody with SKU 5762?

The antibody is a chicken-derived polyclonal antibody with an IgY isotype.

How should the chicken anti-myc tag polyclonal antibody 5762 be stored and what is its storage buffer composition?

The antibody is provided in a liquid form and should be stored in PBS buffer at pH 7.2 containing 0.09% sodium azide (NaN3) as a preservative.

Publications

pmid	title	authors	citation
27998981	Src Acts as an Effector for Ku70-dependent Suppression of Apoptosis through Phosphorylation of Ku70 at Tyr-530.	Mariko Morii, Sho Kubota, Takuya Honda, Ryuzaburo Yuki, Takao Morinaga, Takahisa Kuga, Takeshi Tomonaga, Noritaka Yamaguchi, Naoto Yamaguchi	J Biol Chem 292:1648-1665
26822090	Disulfide Mispairing During Proinsulin Folding in the Endoplasmic Reticulum.	Leena Haataja, Nandini Manickam, Ann Soliman, Billy Tsai, Ming Liu, Peter Arvan	Diabetes 65:1050-60
21043486	Ca2+ homeostasis modulation enhances the amenability of L444P glucosylcerebrosidase to proteostasis regulation in patient-derived fibroblasts.	Fan Wang, Giulia Agnello, Natasha Sotolongo, Laura Segatori	ACS Chem Biol 6:158-68

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.