sheep anti-BSA polyclonal antibody 1031

Price range: $100.00 through $2,600.00

Antibody summary

sheep polyclonal to BSA
Suitable for: ELISA
Reacts with: serum albumin, bovine
Isotype: IgG
100 µg, 25 µg, 1 mg

available sizes

Clear

SKU: 1031parent Categories: antibody, epitope tag Tag: BSA

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	sheep
isotype	IgG
clonality	polyclonal
concentration	1 mg/mL
applications	ELISA
reactivity	cow
available sizes	1 mg, 100 µg, 25 µg

sheep anti-BSA polyclonal antibody 1031

antibody
Database link: bovine P02769
Tested applications ELISA
Recommended dilutions user optimized
Application Notes This antibody reacts with BSA as determined by IEP and ELISA techniques. It is suitable for blotting, ELISA and lateral flow. This antibody may cross react with albumin from other species. Optimal working dilutions should be determined experimentally by the investigator.
Immunogen Highly purified bovine serum albumin (BSA)
Size and concentration 25, 100, 1000µg and 1 mg/mL
Form liquid
Storage Instructions 2-8°C
Storage buffer PBS, pH 7.2, 0.09% NaN₃
Purity affinity purified
Clonality polyclonal
Isotype IgG
Compatible secondaries Donkey Anti-Sheep IgG H&L conjugate
Isotype control Sheep polyclonal - Isotype Control

target relevance
Bos taurus ALB Albumin
Protein names Albumin
Alternative names BSA
Gene names ALB
Protein family Belongs to the ALB/AFP/VDB family
Function Binds water, Ca(2+), Na(+), K(+), fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloidal osmotic pressure of blood. Major zinc transporter in plasma, typically binds about 80% of all plasma zinc (By similarity). Major calcium and magnesium transporter in plasma, binds approximately 45% of circulating calcium and magnesium in plasma (Probable). Potentially has more than two calcium-binding sites and might additionally bind calcium in a non-specific manner (PubMed:22677715). The shared binding site between zinc and calcium at residue Asp-272 suggests a crosstalk between zinc and calcium transport in the blood (Probable). The rank order of affinity is zinc > calcium > magnesium (Probable). Binds to the bacterial siderophore enterobactin and inhibits enterobactin-mediated iron uptake of E.coli, and may thereby limit the utilization of iron and growth of enteric bacteria such as E.coli (PubMed:6234017). Does not prevent iron uptake by the bacterial siderophore aerobactin (PubMed:6234017)
Subcellular location Secreted
Structure Interacts with FCGRT; this interaction regulates ALB homeostasis (By similarity). Interacts with TASOR (By similarity). In plasma, occurs in a covalently-linked complex with chromophore-bound alpha-1-microglobulin; this interaction does not prevent fatty acid binding to ALB
Post-translational modification Phosphorylated by FAM20C in the extracellular medium
Keywords 3D-structure, Allergen, Calcium, Cleavage on pair of basic residues, Copper, Direct protein sequencing, Disulfide bond, Glycation, Glycoprotein, Lipid-binding, Metal-binding, Methylation, Phosphoprotein, Reference proteome, Repeat, Secreted, Signal, Zinc
Sequence MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPF DEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEP ERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYY ANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVA RLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKE CCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRR HPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEK LGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLIL NRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLP DTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVV STQTALA
UniProt accession: P02769

Data

ELISA-image-sheep-anti-BSA-polyclonal-antibody-1031

FAQ & Publications

Frequently Asked Questions

What applications is the sheep anti-BSA polyclonal antibody 1031 suitable for?

This antibody is suitable for ELISA, blotting, and lateral flow assays. It has been validated for reactivity with bovine serum albumin using isoelectric focusing (IEF) and ELISA techniques.

How should the sheep anti-BSA polyclonal antibody 1031 be stored to maintain stability?

The antibody should be stored refrigerated at 2-8°C in PBS buffer at pH 7.2 containing 0.09% sodium azide to ensure optimal stability.

Does the sheep anti-BSA polyclonal antibody 1031 cross-react with albumin from species other than bovine?

Yes, this antibody may cross-react with serum albumin from other species, so users should experimentally determine optimal working dilutions for their specific application and species.

What are the available sizes and concentrations for the sheep anti-BSA polyclonal antibody 1031?

The antibody is provided in liquid form at a concentration of 1 mg/mL, and is available in sizes of 25 µg, 100 µg, and 1 mg.

Publications

pmid	title	authors	citation
23604028	Development of robust and standardized cantilever sensors based on biotin/NeutrAvidin coupling for antibody detection.	Jiayun Zhang, Hans Peter Lang, Felice Battiston, Natalija Backmann, Francois Huber, Christoph Gerber	Sensors (Basel) 13:5273-85

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.