rabbit anti-beta Tubulin monoclonal antibody 9003

$409.00

Antibody summary

Rabbit monoclonal to beta Tubulin
Suitable for: WB,ICC/IF,ELISA
Reacts with: human, mouse, rat
Isotype: IgG
100 µg

SKU: 9003 Categories: antibody, loading control Tag: Beta-Tubulin

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	rabbit
isotype	IgG
clonality	monoclonal
concentration	1 mg/mL
applications	ELISA, ICC/IF, WB
available sizes	100 µg

rabbit anti-beta Tubulin monoclonal antibody 9003

antibody
Database link: human P07437 mouse P99024 rat P69897
Tested applications WB,IHC,IHC,ICC/IF
Recommended dilutions WB: 1:5000-1:10000, ICC/IF and IHC: 1:1000-1:5000
Immunogen Pig brain tubulin preparation
Size and concentration 100µg and 1 mg/mL
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Storage buffer PBS, 50% glycerol, 0.04% NaN₃
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit monocolonal IgG - Isotype Control

target relevance
Homo sapiens TUBB Tubulin beta chain
Protein names Tubulin beta chain
Alternative names Tubulin beta-5 chain
Gene names TUBB
Protein family Belongs to the tubulin family
Function Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers. Microtubules grow by the addition of GTP-tubulin dimers to the microtubule end, where a stabilizing cap forms. Below the cap, tubulin dimers are in GDP-bound state, owing to GTPase activity of alpha-tubulin
Subcellular location Cytoplasm, cytoskeleton
Structure Heterodimer of alpha and beta chains (PubMed:26637975). A typical microtubule is a hollow water-filled tube with an outer diameter of 25 nm and an inner diameter of 15 nM. Alpha-beta heterodimers associate head-to-tail to form protofilaments running lengthwise along the microtubule wall with the beta-tubulin subunit facing the microtubule plus end conferring a structural polarity. Microtubules usually have 13 protofilaments but different protofilament numbers can be found in some organisms and specialized cells. Interacts with CIMAP3 (PubMed:20643351). Interacts with DIAPH1 (PubMed:23325789). Interacts with MX1 (By similarity). May interact with RNABP10 (By similarity). Interacts with CFAP157 (By similarity). Nascent tubulin polypeptide interacts (via beta-tubulin MREI motif) with TTC5/STRAP; this interaction results in tubulin mRNA-targeted degradation (PubMed:31727855)
Post-translational modification Some glutamate residues at the C-terminus are polyglutamylated, resulting in polyglutamate chains on the gamma-carboxyl group (PubMed:26875866, PubMed:28576883). Polyglutamylation plays a key role in microtubule severing by spastin (SPAST). SPAST preferentially recognizes and acts on microtubules decorated with short polyglutamate tails: severing activity by SPAST increases as the number of glutamates per tubulin rises from one to eight, but decreases beyond this glutamylation threshold (PubMed:26875866). Glutamylation is also involved in cilia motility (By similarity) Some glutamate residues at the C-terminus are monoglycylated but not polyglycylated due to the absence of functional TTLL10 in human. Monoglycylation is mainly limited to tubulin incorporated into cilia and flagella axonemes, which is required for their stability and maintenance. Flagella glycylation controls sperm motility (Probable) (PubMed:28576883). Both polyglutamylation and monoglycylation can coexist on the same protein on adjacent residues, and lowering glycylation levels increases polyglutamylation, and reciprocally (Probable) (PubMed:28576883) Phosphorylated on Ser-172 by CDK1 during the cell cycle, from metaphase to telophase, but not in interphase. This phosphorylation inhibits tubulin incorporation into microtubules
Involvement in disease Cortical dysplasia, complex, with other brain malformations 6 A disorder of aberrant neuronal migration and disturbed axonal guidance. Affected individuals have microcephaly, ataxia, and severe delayed psychomotor development. Brain imaging shows variable malformations of cortical development, including white matter streaks, dysmorphic basal ganglia, corpus callosum abnormalities, brainstem and cerebellar hypoplasia, cortical dysplasia, polymicrogyria. Skin creases, congenital symmetric circumferential, 1 An autosomal dominant disease characterized by multiple, symmetric, circumferential rings of folded skin, affecting primarily the limbs. Affected individuals also exhibit intellectual disability, cleft palate, and dysmorphic features.
Keywords 3D-structure, Acetylation, Cytoplasm, Cytoskeleton, Direct protein sequencing, Disease variant, GTP-binding, Isopeptide bond, Magnesium, Metal-binding, Methylation, Microtubule, Nucleotide-binding, Phosphoprotein, Proteomics identification, Reference proteome, Ubl conjugation
Sequence MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYV PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMM AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG LKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS EYQQYQDATAEEEEDFGEEAEEEA
UniProt accession: P07437

Data

benchmarkantibodies.com/wp-content/uploads/2024/03/9003_1.jpg

Detection of mouse beta-Tubulin by immunohistochemistry. Sample: FFPE section of mouse testis. Antibody: Rabbit anti-beta-Tubulin recombinant monoclonal antibody. Secondary: HRP-conjugated goat anti-rabbit IgG.

benchmarkantibodies.com/wp-content/uploads/2024/03/9003_2.jpg

Detection of mouse beta-Tubulin by Western blot. Samples: Whole cell lysate (10 µg) from NIH 3T3, CT26, CH27, TCMK-1, and BW5147.3 cells prepared using NETN lysis buffer. Antibody: Rabbit anti-beta-Tubulin recombinant monoclonal antibody used at 1:1000. Secondary: HRP-conjugated goat anti-rabbit IgG. Detection: Chemiluminescence with an exposure time of 10 seconds. Lower Panel: Rabbit anti-Actin recombinant monoclonal antibody.

FAQ & Publications

Frequently Asked Questions

What applications is the rabbit anti-beta Tubulin monoclonal antibody 9003 suitable for?

This antibody is validated for use in Western blotting (WB), immunocytochemistry/immunofluorescence (ICC/IF), and enzyme-linked immunosorbent assay (ELISA). Recommended dilutions are 1:5000-1:10000 for WB and 1:1000-1:5000 for ICC/IF and immunohistochemistry (IHC).

Which species does this beta Tubulin antibody react with?

The rabbit anti-beta Tubulin monoclonal antibody 9003 reacts with human, mouse, and rat beta Tubulin proteins.

How should the rabbit anti-beta Tubulin monoclonal antibody 9003 be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C. Avoid repeated freeze/thaw cycles to maintain antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.