Skip to content

mouse anti-ERK1/2 monoclonal antibody (E31R) 1916

Price range: $100.00 through $2,600.00

Antibody summary

  • Mouse monoclonal to ERK1/2
  • Suitable for: WB
  • Reacts with: human
  • Isotype: IgG1
  • 100 µg, 25 µg, 1 mg
SKU: 1916parent Categories: , Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG1

clonality

monoclonal

concentration

1 mg/mL

applications

WB

reactivity

human

available sizes

1 mg, 100 µg, 25 µg

mouse anti-ERK1/2 monoclonal antibody (E31R) 1916

antibody
Database link:
human ERK1 P27361
human ERK2 P28482
Tested applications
WB
Recommended dilutions
WB: 1:1000
Immunogen
Full length recombinant human ERK1 protein
Size and concentration
25, 100, 1000µg and 1 mg/mL
Form
liquid
Storage Instructions
-20°C for 2 years or more. Centrifuge after first thaw to maximize product recovery. Aliquot to avoid repeated freeze-thaw cycles. Store aliquots at 4°C for several days to weeks.
Storage buffer
PBS, pH 7.2, 0.05% NaN3
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG1
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monocolonal IgG1 - Isotype Control
target relevance
Homo sapiens MAPK3
Mitogen-activated protein kinase 3
Protein names
Mitogen-activated protein kinase 3
Alternative names
ERT2, Extracellular signal-regulated kinase 1, Insulin-stimulated MAP2 kinase, MAP kinase isoform p44, Microtubule-associated protein 2 kinase, p44-ERK1
Gene names
MAPK3
Protein family
Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily
Function
Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway (PubMed:34497368). MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF. Depending on the cellular context, the MAPK/ERK cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. The MAPK/ERK cascade also plays a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. About 160 substrates have already been discovered for ERKs. Many of these substrates are localized in the nucleus, and seem to participate in the regulation of transcription upon stimulation. However, other substrates are found in the cytosol as well as in other cellular organelles, and those are responsible for processes such as translation, mitosis and apoptosis. Moreover, the MAPK/ERK cascade is also involved in the regulation of the endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC); as well as in the fragmentation of the Golgi apparatus during mitosis. The substrates include transcription factors (such as ATF2, BCL6, ELK1, ERF, FOS, HSF4 or SPZ1), cytoskeletal elements (such as CANX, CTTN, GJA1, MAP2, MAPT, PXN, SORBS3 or STMN1), regulators of apoptosis (such as BAD, BTG2, CASP9, DAPK1, IER3, MCL1 or PPARG), regulators of translation (such as EIF4EBP1) and a variety of other signaling-related molecules (like ARHGEF2, DEPTOR, FRS2 or GRB10) (PubMed:35216969). Protein kinases (such as RAF1, RPS6KA1/RSK1, RPS6KA3/RSK2, RPS6KA2/RSK3, RPS6KA6/RSK4, SYK, MKNK1/MNK1, MKNK2/MNK2, RPS6KA5/MSK1, RPS6KA4/MSK2, MAPKAPK3 or MAPKAPK5) and phosphatases (such as DUSP1, DUSP4, DUSP6 or DUSP16) are other substrates which enable the propagation the MAPK/ERK signal to additional cytosolic and nuclear targets, thereby extending the specificity of the cascade. Phosphorylates GJA1 at 'Ser-279' and 'Ser-282' resulting in an increase in GJA1 ubiquitination and ultimately lysosomal degradation (By similarity)
Catalytic activity
L-seryl-[protein] + ATP = O-phospho-L-seryl-[protein] + ADP + H(+)
L-threonyl-[protein] + ATP = O-phospho-L-threonyl-[protein] + ADP + H(+)
Subcellular location
Cytoplasm, Nucleus, Membrane, caveola, Cell junction, focal adhesion
Structure
(Microbial infection) Binds to HIV-1 Nef through its SH3 domain. This interaction inhibits its tyrosine-kinase activity
Post-translational modification
Phosphorylated upon KIT and FLT3 signaling (By similarity). Dually phosphorylated on Thr-202 and Tyr-204, which activates the enzyme. Ligand-activated ALK induces tyrosine phosphorylation. Dephosphorylated by PTPRJ at Tyr-204
Ubiquitinated by TRIM15 via 'Lys-63'-linked ubiquitination; leading to activation. Deubiquitinated by CYLD
Keywords
3D-structure, Acetylation, Alternative splicing, Apoptosis, ATP-binding, Cell cycle, Cell junction, Cytoplasm, Direct protein sequencing, Host-virus interaction, Kinase, Membrane, Nucleotide-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Serine/threonine-protein kinase, Transferase, Ubl conjugation
Sequence
MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL KELIFQETARFQPGVLEAP
UniProt accession: P27361

Data

WB-image-mouse-anti-ERK1/2-monoclonal-antibody-E31R-1916
1:1000 (1µg/mL) Ab dilution used in WB of 10µg (1) and 30µg (2) HeLa cell lysates.

FAQ & Publications

Frequently Asked Questions
What species does the mouse anti-ERK1/2 monoclonal antibody (E31R) react with?
This antibody is reactive with human ERK1 and ERK2 proteins.
For which application is the mouse anti-ERK1/2 monoclonal antibody (E31R) validated?
The antibody is suitable and validated for use in Western Blot (WB) applications.
How should the mouse anti-ERK1/2 monoclonal antibody (E31R) be stored to maintain stability?
Store the antibody at -20°C for long-term storage up to 2 years or more. After the first thaw, centrifuge to maximize recovery, aliquot to avoid repeated freeze-thaw cycles, and store aliquots at 4°C for several days to weeks.
What is the recommended dilution for the mouse anti-ERK1/2 monoclonal antibody (E31R) in Western Blot experiments?
A dilution of 1:1000 is recommended for Western Blot applications.
What is the immunogen used to generate the mouse anti-ERK1/2 monoclonal antibody (E31R)?
The antibody was raised against full-length recombinant human ERK1 protein.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.