rabbit anti-Hsp60 polyclonal antibody 9023

$409.00

Antibody summary

Rabbit polyclonal to Hsp60
Suitable for: WB, ICC/IF, IHC
Reacts with: human, mouse, rat
Isotype: IgG
100 µg

SKU: 9023 Categories: antibody, loading control Tag: Hsp60

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	rabbit
isotype	IgG
clonality	polyclonal
concentration	1 mg/mL
applications	ICC/IF, IHC, WB
available sizes	100 µg

rabbit anti-Hsp60 polyclonal antibody 9023

antibody
Database link: human P10809 mouse P63038 rat P63039
Tested applications WB,IHC,IHC,ICC/IF
Recommended dilutions WB: 1:5000-10000 ICC/IF and IHC: 1:5000
Immunogen Recombinant full length human HSP60 expressed in and purified from E. coli
Size and concentration 100µg and 1 mg/mL
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Storage buffer PBS, 50% glycerol, 0.04% NaN₃
Purity serum
Clonality polyclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens HSPD1 60 kDa heat shock protein, mitochondrial
Protein names 60 kDa heat shock protein, mitochondrial
Alternative names 60 kDa chaperonin, Chaperonin 60, Heat shock protein 60, Heat shock protein family D member 1, HuCHA60, Mitochondrial matrix protein P1, P60 lymphocyte protein
Gene names HSPD1
Protein family Belongs to the chaperonin (HSP60) family
Function Chaperonin implicated in mitochondrial protein import and macromolecular assembly. Together with Hsp10, facilitates the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded polypeptides generated under stress conditions in the mitochondrial matrix (PubMed:11422376, PubMed:1346131). The functional units of these chaperonins consist of heptameric rings of the large subunit Hsp60, which function as a back-to-back double ring. In a cyclic reaction, Hsp60 ring complexes bind one unfolded substrate protein per ring, followed by the binding of ATP and association with 2 heptameric rings of the co-chaperonin Hsp10. This leads to sequestration of the substrate protein in the inner cavity of Hsp60 where, for a certain period of time, it can fold undisturbed by other cell components. Synchronous hydrolysis of ATP in all Hsp60 subunits results in the dissociation of the chaperonin rings and the release of ADP and the folded substrate protein (Probable)
Catalytic activity ATP + H2O + an unfolded polypeptide = ADP + phosphate + a folded polypeptide.
Subcellular location Mitochondrion matrix
Structure (Microbial infection) Interacts with HTLV-1 protein p40tax
Involvement in disease Spastic paraplegia 13, autosomal dominant A form of spastic paraplegia, a neurodegenerative disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs. Rate of progression and the severity of symptoms are quite variable. Initial symptoms may include difficulty with balance, weakness and stiffness in the legs, muscle spasms, and dragging the toes when walking. In some forms of the disorder, bladder symptoms (such as incontinence) may appear, or the weakness and stiffness may spread to other parts of the body. Leukodystrophy, hypomyelinating, 4 A severe autosomal recessive hypomyelinating leukodystrophy. Clinically characterized by infantile-onset rotary nystagmus, progressive spastic paraplegia, neurologic regression, motor impairment, profound intellectual disability. Death usually occurs within the first two decades of life.
Keywords 3D-structure, Acetylation, Alternative splicing, ATP-binding, Chaperone, Direct protein sequencing, Disease variant, Hereditary spastic paraplegia, Host-virus interaction, Isomerase, Isopeptide bond, Leukodystrophy, Mitochondrion, Neurodegeneration, Nucleotide-binding, Phosphoprotein, Proteomics identification, Reference proteome, Transit peptide, Ubl conjugation
Sequence MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGR TVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLA RSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDK EIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQ DAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAV KAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKG KGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDR VTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIA KNAGVEGSLIVEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLT TAEVVVTEIPKEEKDPGMGAMGGMGGGMGGGMF
UniProt accession: P10809

Data

benchmarkantibodies.com/wp-content/uploads/2024/03/9023_1.jpg

Detection of human and mouse HSP60 by western blot (h&m) and immunoprecipitation (h). Samples: Whole cell lysate from HeLa (5, 15 and 50 µg for WB; 1 mg for IP, 20% of IP loaded), HEK293T (T; 50 µg), and mouse NIH 3T3 (M; 50 µg) cells. Antibodies: Affinity purified rabbit anti-HSP60 antibody used for WB at 0.04 µg/ml (A) and 0.4 µg/ml (B) and used for IP at 3 µg/mg lysate. HSP60 was also immunoprecipitated by rabbit anti-HSP60 antibodies, which recognize other epitopes. Detection: Chemiluminescence with exposure times of 10 seconds (A and B).

benchmarkantibodies.com/wp-content/uploads/2024/03/9023_2.jpg

Detection of human HSP60 by immunohistochemistry. Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-HSP60 used at a dilution of 1:200 (1µg/ml). Detection: Vector Laboratories ImmPACT NovaRED Peroxidase Substrate

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-Hsp60 polyclonal antibody 9023 react with?

This antibody reacts with human, mouse, and rat species.

Which applications has the rabbit anti-Hsp60 polyclonal antibody 9023 been validated for?

It has been tested and is suitable for Western blot (WB), immunocytochemistry/immunofluorescence (ICC/IF), and immunohistochemistry (IHC).

How should the rabbit anti-Hsp60 polyclonal antibody 9023 be stored for optimal stability?

For short-term storage, keep the antibody at 2-8°C, and for long-term storage, keep it at -20°C while avoiding repeated freeze/thaw cycles.

What is the immunogen used to generate the rabbit anti-Hsp60 polyclonal antibody 9023?

The immunogen is recombinant full-length human HSP60 protein expressed and purified from E. coli.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.