Immunohistochemistry (IHC) : Human type B1 thymoma stained with anti-TdT antibody. Note the immature T-cells are positive.

rabbit anti-TdT monoclonal antibody (ZR446) 6377

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to TdT
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Thymus
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6377parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Hematopathology, TdT

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-TdT monoclonal antibody ZR446 6377

antibody
Database link: human P04053
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Thymus
Immunogen Recombinant fragment (around aa 52-192) of human DNTT protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens DNTT DNA nucleotidylexotransferase
Protein names DNA nucleotidylexotransferase
Alternative names Terminal addition enzyme, Terminal deoxynucleotidyltransferase
Gene names DNTT
Protein family Belongs to the DNA polymerase type-X family
Function Template-independent DNA polymerase which catalyzes the random addition of deoxynucleoside 5'-triphosphate to the 3'-end of a DNA initiator. One of the in vivo functions of this enzyme is the addition of nucleotides at the junction (N region) of rearranged Ig heavy chain and T-cell receptor gene segments during the maturation of B- and T-cells
Catalytic activity DNA(n) + a 2'-deoxyribonucleoside 5'-triphosphate = DNA(n+1) + diphosphate
Subcellular location Nucleus
Structure Interacts with PRP19 and DNTTIP1. Forms a ternary complex with DNTTIP2 and core histone. Released from this complex by PCNA. Interacts with TRERF1 (PubMed:16371131)
Keywords 3D-structure, Alternative splicing, Magnesium, Metal-binding, Nucleotidyltransferase, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Terminal addition, Transferase
Sequence MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKG FRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIECIRAGKPVEMT GKHQLVVRRDYSDSTNPGPPKTPPIAVQKISQYACQRRTTLNNCNQIFTDAFDILAENCE FRENEDSCVTFMRAASVLKSLPFTIISMKDTEGIPCLGSKVKGIIEEIIEDGESSEVKAV LNDERYQSFKLFTSVFGVGLKTSEKWFRMGFRTLSKVRSDKSLKFTRMQKAGFLYYEDLV SCVTRAEAEAVSVLVKEAVWAFLPDAFVTMTGGFRRGKKMGHDVDFLITSPGSTEDEEQL LQKVMNLWEKKGLLLYYDLVESTFEKLRLPSRKVDALDHFQKCFLIFKLPRQRVDSDQSS WQEGKTWKAIRVDLVLCPYERRAFALLGWTGSRQFERDLRRYATHERKMILDNHALYDKT KRIFLKAESEEEIFAHLGLDYIEPWERNA
UniProt accession: P04053

Data

Human type B1 thymoma stained with anti-TdT antibody. Note the immature T-cells are positive.

FAQ & Publications

Frequently Asked Questions

What applications is the rabbit anti-TdT monoclonal antibody ZR446 suitable for?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the rabbit anti-TdT monoclonal antibody be stored to maintain stability?

Store the antibody at 2-8°C for short term use, and for longer term storage, keep it at -20°C while avoiding repeated freeze/thaw cycles.

What species does the rabbit anti-TdT monoclonal antibody react with, and what is the recommended positive control?

The antibody reacts with human tissues, and thymus tissue is recommended as a positive control for validation.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.