Immunohistochemistry (IHC) : Human tonsil stained with anti-TCL1 using peroxidase-conjugate and DAB chromogen. Note strong nuclear staining of perifollicular B lymphocytes.

mouse anti-TCL1 monoclonal antibody (ZM92) 6376

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to TCL1
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Tonsil
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6376parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Hematopathology, TCL1

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-TCL1 monoclonal antibody ZM92 6376

antibody
Database link: human P56279
Tested applications IHC
Recommended dilutions Concentrated 1:50-100
Application Notes Positive control: Tonsil
Immunogen Recombinant human TCL1 protein fragment (around aa 2-109)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens TCL1A T-cell leukemia/lymphoma protein 1A
Protein names T-cell leukemia/lymphoma protein 1A
Alternative names Oncogene TCL-1, Protein p14 TCL1
Gene names TCL1A
Protein family Belongs to the TCL1 family
Function Enhances the phosphorylation and activation of AKT1, AKT2 and AKT3. Promotes nuclear translocation of AKT1. Enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival
Subcellular location Cytoplasm, Nucleus, Microsome, Endoplasmic reticulum
Structure Homodimer. Interacts with AKT1, AKT2 and AKT3 (via PH domain). Interacts with PNPT1; the interaction has no effect on PNPT1 exonuclease activity
Keywords 3D-structure, Chromosomal rearrangement, Cytoplasm, Endoplasmic reticulum, Microsome, Nucleus, Proteomics identification, Proto-oncogene, Reference proteome
Sequence MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGR PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
UniProt accession: P56279

Data

Human tonsil stained with anti-TCL1 using peroxidase-conjugate and DAB chromogen. Note strong nuclear staining of perifollicular B lymphocytes.

FAQ & Publications

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.