Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human tonsil stained with anti-TRAcP antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of B cells

rabbit anti-TRAcP monoclonal antibody (ZR234) 6390

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to TRAcP
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Hairy cell leukemia
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6390parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Hematopathology, TRAcP

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-TRAcP monoclonal antibody ZR234 6390

antibody
Database link: human P13686
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Hairy cell leukemia
Immunogen Recombinant full-length human ACP5 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens ACP5 Tartrate-resistant acid phosphatase type 5
Protein names Tartrate-resistant acid phosphatase type 5
Alternative names Tartrate-resistant acid ATPase, Type 5 acid phosphatase
Gene names ACP5
Protein family Belongs to the metallophosphoesterase superfamily. Purple acid phosphatase family
Function Involved in osteopontin/bone sialoprotein dephosphorylation. Its expression seems to increase in certain pathological states such as Gaucher and Hodgkin diseases, the hairy cell, the B-cell, and the T-cell leukemias
Catalytic activity a phosphate monoester + H2O = an alcohol + phosphate
Subcellular location Lysosome
Structure Exists either as monomer or, after proteolytic processing, as a dimer of two chains linked by disulfide bond(s)
Involvement in disease Spondyloenchondrodysplasia with immune dysregulation A disease characterized by vertebral and metaphyseal dysplasia, spasticity with cerebral calcifications, and strong predisposition to autoimmune diseases. The skeletal dysplasia is characterized by radiolucent and irregular spondylar and metaphyseal lesions that represent islands of chondroid tissue within bone.
Keywords 3D-structure, Direct protein sequencing, Disease variant, Disulfide bond, Glycoprotein, Hydrolase, Iron, Lysosome, Metal-binding, Proteomics identification, Reference proteome, Signal
Sequence MDMWTALLILQALLLPSLADGATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQI LGADFILSLGDNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ IAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERPRDVKL ARTQLSWLKKQLAAAREDYVLVAGHYPVWSIAEHGPTHCLVKQLRPLLATYGVTAYLCGH DHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLRFHYGTEDSLGGFAYVEISSK EMTVTYIEASGKSLFKTRLPRRARP
UniProt accession: P13686

Data

Formalin-fixed, paraffin-embedded human tonsil stained with anti-TRAcP antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of B cells

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-TRAcP monoclonal antibody (ZR234) specifically react with?

This antibody specifically reacts with human species.

Which applications is the rabbit anti-TRAcP monoclonal antibody validated for?

It is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the rabbit anti-TRAcP monoclonal antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C, and for long-term storage, freeze it at -20°C. Avoid repeated freeze/thaw cycles.

What is the recommended dilution for using the concentrated form of this antibody in IHC?

The concentrated antibody should be diluted at 1:100 to 1:200 for immunohistochemistry applications.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.