Immunohistochemistry (IHC) : Human prostate stained with anti-PSAP antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of benign prostate glands.

rabbit anti-PSAP monoclonal antibody (ZR443) 6350

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to PSAP
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Human prostate
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6350parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, monoclonal, PSAP, Urinary Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-PSAP monoclonal antibody ZR443 6350

antibody
Database link: human O14601
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Human prostate
Immunogen Recombinant human ACPP fragment
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens ACP3 Prostatic acid phosphatase
Protein names Prostatic acid phosphatase
Alternative names 5'-nucleotidase, Acid phosphatase 3, Ecto-5'-nucleotidase, Protein tyrosine phosphatase ACP3, Thiamine monophosphatase
Gene names ACP3
Protein family Belongs to the histidine acid phosphatase family
Function A non-specific tyrosine phosphatase that dephosphorylates a diverse number of substrates under acidic conditions (pH 4-6) including alkyl, aryl, and acyl orthophosphate monoesters and phosphorylated proteins (PubMed:10506173, PubMed:15280042, PubMed:20498373, PubMed:9584846). Has lipid phosphatase activity and inactivates lysophosphatidic acid in seminal plasma (PubMed:10506173, PubMed:15280042)
Catalytic activity a phosphate monoester + H2O = an alcohol + phosphate 1-(9Z-octadecenoyl)-sn-glycero-3-phosphate + H2O = 1-(9Z-octadecenoyl)-sn-glycerol + phosphate a ribonucleoside 5'-phosphate + H2O = a ribonucleoside + phosphate O-phospho-L-tyrosyl-[protein] + H2O = L-tyrosyl-[protein] + phosphate
Subcellular location Cell membrane, Lysosome membrane, Nucleus, Cytoplasm, cytosol
Structure Homodimer; dimer formation is required for phosphatase activity
Post-translational modification N-glycosylated. High mannose content, partially sialylated and fucosylated biantennary complex. Also fucosylated with partially sialylated triantennary complex oligosaccharides Proteolytically cleaved in seminal fluid to produce several peptides. Peptide PAPf39, the most prominent, forms amyloid beta-sheet fibrils, SEVI (semen-derived enhancer of viral infection)
Keywords 3D-structure, Alternative splicing, Amyloid, Cell membrane, Cytoplasm, Direct protein sequencing, Disulfide bond, Glycoprotein, Hydrolase, Lipid metabolism, Lysosome, Membrane, Nucleus, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLVFRHGDRSPIDTFPTDPIKE SSWPQGFGQLTQLGMEQHYELGEYIRKRYRKFLNESYKHEQVYIRSTDVDRTLMSAMTNL AALFPPEGVSIWNPILLWQPIPVHTVPLSEDQLLYLPFRNCPRFQELESETLKSEEFQKR LHPYKDFIATLGKLSGLHGQDLFGIWSKVYDPLYCESVHNFTLPSWATEDTMTKLRELSE LSLLSLYGIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMYSAHDTTVSGLQMAL DVYNGLLPPYASCHLTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELV GPVIPQDWSTECMTTNSHQGTEDSTD
UniProt accession: P15309

Data

Human prostate stained with anti-PSAP antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of benign prostate glands.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-PSAP monoclonal antibody (ZR443) specifically react with?

This antibody is reactive with human species, making it suitable for studies involving human tissue samples.

What is the recommended dilution for using the concentrated rabbit anti-PSAP monoclonal antibody in immunohistochemistry (IHC)?

For IHC applications using the concentrated antibody, a dilution range of 1:100 to 1:200 is recommended.

How should the rabbit anti-PSAP monoclonal antibody be stored to maintain its stability?

The antibody should be stored at 2-8°C for short-term use. For long-term storage, it is advised to keep the antibody at -20°C and avoid repeated freeze-thaw cycles to preserve its activity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.