mouse anti-Cytokeratin 7 monoclonal antibody (OV-TL-12&30) 5423

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Cytokeratin 7
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Ovarian carcinoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 5423parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Cytokeratin 7, Urinary Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Cytokeratin 7 monoclonal antibody OV-TL-12&30 5423

antibody
Database link: human P08729
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Ovarian carcinoma
Immunogen OTN II ovarian carcinoma cell line
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens KRT7 Keratin, type II cytoskeletal 7
Protein names Keratin, type II cytoskeletal 7
Alternative names Cytokeratin-7, Keratin-7, Sarcolectin, Type-II keratin Kb7
Gene names KRT7
Protein family Belongs to the intermediate filament family
Function Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7)
Subcellular location Cytoplasm
Structure (Microbial infection) Interacts with human papillomavirus 16/HPV16 protein E7
Post-translational modification Arg-20 is dimethylated, probably to asymmetric dimethylarginine
Keywords 3D-structure, Acetylation, Coiled coil, Cytoplasm, Direct protein sequencing, Glycoprotein, Host-virus interaction, Intermediate filament, Isopeptide bond, Keratin, Methylation, Phosphoprotein, Proteomics identification, Reference proteome, Ubl conjugation
Sequence MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVG AGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLE TKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKY EDEINHRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQI SDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDD LRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAA LQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTG GSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD
UniProt accession: P08729

Data

Human ovarian carcinoma stained with anti-Keratin 7 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-Cytokeratin 7 monoclonal antibody (OV-TL-12&30) specifically react with?

This antibody specifically reacts with human tissues.

Which applications is the mouse anti-Cytokeratin 7 monoclonal antibody (OV-TL-12&30) validated for?

It is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for the mouse anti-Cytokeratin 7 monoclonal antibody to maintain its stability?

For short-term storage, keep the antibody at 2-8°C, and for long-term storage, it should be stored at -20°C, avoiding repeated freeze/thaw cycles.

What is the immunogen used to generate the mouse anti-Cytokeratin 7 monoclonal antibody (OV-TL-12&30)?

The immunogen is the OTN II ovarian carcinoma cell line.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.