Immunohistochemistry (IHC) : Human urothelial carcinoma stained with anti-Thrombomodulin antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells.

mouse anti-Thrombomodulin/ CD141 monoclonal antibody (ZM105) 6380

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Thrombomodulin/ CD141
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2a
Control: Mesothelioma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6380parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Thrombomodulin/ CD141, Urinary Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2a
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Thrombomodulin/ CD141 monoclonal antibody ZM105 6380

antibody
Database link: human P07204
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Mesothelioma
Immunogen Recombinant human thrombomodulin protein fragment (aa69-194)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2a
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2a - Isotype Control

target relevance
Homo sapiens THBD Thrombomodulin
Protein names Thrombomodulin
Alternative names Fetomodulin
Gene names THBD
Function Endothelial cell receptor that plays a critical role in regulating several physiological processes including hemostasis, coagulation, fibrinolysis, inflammation, and angiogenesis (PubMed:10761923). Acts as a cofactor for thrombin activation of protein C/PROC on the surface of vascular endothelial cells leading to initiation of the activated protein C anticoagulant pathway (PubMed:29323190, PubMed:33836597, PubMed:9395524). Also accelerates the activation of the plasma carboxypeptidase B2/CPB2, which catalyzes removal of C-terminal basic amino acids from its substrates including kinins or anaphylatoxins leading to fibrinolysis inhibition (PubMed:26663133). Plays critical protective roles in changing the cleavage specificity of protease-activated receptor 1/PAR1, inhibiting endothelial cell permeability and inflammation (By similarity). Suppresses inflammation distinctly from its anticoagulant cofactor activity by sequestering HMGB1 thereby preventing it from engaging cellular receptors such as RAGE and contributing to the inflammatory response (PubMed:15841214)
Subcellular location Membrane
Structure Interacts with ITGAL, ITGAM and ITGB2. Interacts with thrombin/F2; this interaction switches the specificity of thrombin from a procoagulant to an anticoagulant and antifibrinolytic protease (PubMed:10761923). Interacts with ANGP1 and ANGP2; these interactions significantly inhibit the generation of activated PC and TAFIa/CPB2 by the thrombin/thrombomodulin complex (PubMed:29323190). Interacts with PF4; this interaction enhances generation of activated protein C (PubMed:9395524). Interacts with HMGB1; this interaction inhibits HMGB1 inflammatory activity (PubMed:15841214)
Post-translational modification N-glycosylated The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains
Involvement in disease Thrombophilia due to thrombomodulin defect A hemostatic disorder characterized by a tendency to thrombosis. Hemolytic uremic syndrome, atypical, 6 An atypical form of hemolytic uremic syndrome. It is a complex genetic disease characterized by microangiopathic hemolytic anemia, thrombocytopenia, renal failure and absence of episodes of enterocolitis and diarrhea. In contrast to typical hemolytic uremic syndrome, atypical forms have a poorer prognosis, with higher death rates and frequent progression to end-stage renal disease.
Keywords 3D-structure, Blood coagulation, Direct protein sequencing, Disease variant, Disulfide bond, EGF-like domain, Glycoprotein, Hemolytic uremic syndrome, Hemostasis, Hydroxylation, Membrane, Proteoglycan, Proteomics identification, Receptor, Reference proteome, Repeat, Signal, Thrombophilia, Transmembrane, Transmembrane helix
Sequence MLGVLVLGALALAGLGFPAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLM TVRSSVAADVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYS RWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAV EPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLQLMCTAPPGAVQGHWAREAP GAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSCTASATQSCNDLCEHFCVPNP DQPGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQRCVNTQGGFECHCYPNYDLVDG ECVEPVDPCFRANCEYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADCDPN TQASCECPEGYILDDGFICTDIDECENGGFCSGVCHNLPGTFECICGPDSALARHIGTDC DSGKVDGGDSGSGEPPPSPTPGSTLTPPAVGLVHSGLLIGISIASLCLVVALLALLCHLR KKQGAARAKMEYKCAAPSKEVVLQHVRTERTPQRL
UniProt accession: P07204

Data

Human urothelial carcinoma stained with anti-Thrombomodulin antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-Thrombomodulin/CD141 monoclonal antibody (ZM105) specifically react with?

This antibody specifically reacts with human Thrombomodulin/CD141.

What are the recommended storage conditions for the mouse anti-Thrombomodulin/CD141 antibody to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C, and freeze/thaw cycles should be avoided to preserve antibody integrity.

Which applications is the mouse anti-Thrombomodulin/CD141 monoclonal antibody validated for, and what is the suggested dilution for concentrated antibody use?

This antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues. The recommended dilution for the concentrated antibody is between 1:100 and 1:200.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.