Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human normal kidney stained with anti-PAX-2 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tubular cells

rabbit anti-PAX-2 monoclonal antibody (ZR224) 6319

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to PAX-2
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Renal cell carcinoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6319parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, monoclonal, PAX-2, Urinary Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-PAX-2 monoclonal antibody ZR224 6319

antibody
Database link: human Q02962
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Renal cell carcinoma
Immunogen Recombinant fragment (around aa 223-354) of human PAX2 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens PAX2 Paired box protein Pax-2
Protein names Paired box protein Pax-2
Gene names PAX2
Function Transcription factor that may have a role in kidney cell differentiation (PubMed:24676634). Has a critical role in the development of the urogenital tract, the eyes, and the CNS
Subcellular location Nucleus
Structure Interacts with ELGN3; the interaction targets PAX2 for destruction. Interacts with TLE4
Involvement in disease Papillorenal syndrome An autosomal dominant disorder characterized by both ocular and renal anomalies, but may also include vesicoureteral reflux, high frequency hearing loss, central nervous system anomalies, and/or genital anomalies. Eye anomalies in this disorder consist of a wide and sometimes excavated dysplastic optic disk with the emergence of the retinal vessels from the periphery of the disk, designated optic nerve coloboma or 'morning glory' anomaly. Associated findings may include a small corneal diameter, retinal coloboma, scleral staphyloma, optic nerve cyst, microphthalmia, and pigmentary macular dysplasia. The kidneys are small and abnormally formed (renal hypodysplasia), and have fewer than the normal number of glomeruli, which are enlarged (oligomeganephronia). These ocular and renal anomalies result in decreased visual acuity and retinal detachment, as well as hypertension, proteinuria, and renal insufficiency that frequently progresses to end-stage renal disease. Focal segmental glomerulosclerosis 7 A renal pathology defined by the presence of segmental sclerosis in glomeruli and resulting in proteinuria, reduced glomerular filtration rate and progressive decline in renal function. Renal insufficiency often progresses to end-stage renal disease, a highly morbid state requiring either dialysis therapy or kidney transplantation.
Keywords Alternative splicing, Developmental protein, Differentiation, Disease variant, DNA-binding, Nucleus, Paired box, Phosphoprotein, Proteomics identification, Reference proteome, Transcription, Transcription regulation
Sequence MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRV SHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLA EGICDNDTVPSVSSINRIIRTKVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASND PVGSYSINGILGIPRSNGEKRKRDEVEVYTDPAHIRGGGGLHLVWTLRDVSEGSVPNGDS QSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGL DEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQGSYPTSTLAG MVPGSEFSGNPYSHPQYTAYNEAWRFSNPALLSSPYYYSAAPRGSAPAAAAAAYDRH
UniProt accession: Q02962

Data

Formalin-fixed, paraffin-embedded human normal kidney stained with anti-PAX-2 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tubular cells

FAQ & Publications

Frequently Asked Questions

What species is the rabbit anti-PAX-2 monoclonal antibody (ZR224) validated to react with?

This antibody is validated for reactivity with human tissue samples only.

Which applications is this rabbit anti-PAX-2 monoclonal antibody recommended for?

It is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the rabbit anti-PAX-2 monoclonal antibody be stored to maintain stability?

For short term storage, keep the antibody at 2-8°C, and for long term storage, freeze at -20°C. Avoid repeated freeze-thaw cycles to preserve antibody integrity.

What is the recommended dilution range for using the concentrated form of this rabbit anti-PAX-2 antibody in IHC?

The recommended dilution for the concentrated antibody is between 1:100 and 1:200 for immunohistochemistry applications.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.