Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human prostate stained with anti-PAS antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of glandular cells.

rabbit anti-PSA monoclonal antibody (ZR232) 6348

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to PSA
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Prostate
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6348parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, monoclonal, PSA, Urinary Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-PSA monoclonal antibody ZR232 6348

antibody
Database link: human P07288
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Prostate
Immunogen Recombinant fragment (around aa150-250) of human KLK3 protein (exact sequence is proprietary)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens KLK3 Prostate-specific antigen
Protein names Prostate-specific antigen
Alternative names Gamma-seminoprotein, Kallikrein-3, P-30 antigen, Semenogelase
Gene names KLK3
Protein family Belongs to the peptidase S1 family. Kallikrein subfamily
Function Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum
Catalytic activity Preferential cleavage: -Tyr-\|-Xaa-.
Subcellular location Secreted
Structure Forms a heterodimer with SERPINA5
Keywords 3D-structure, Alternative splicing, Direct protein sequencing, Disulfide bond, Glycoprotein, Hydrolase, Protease, Proteomics identification, Reference proteome, Secreted, Serine protease, Signal, Zymogen
Sequence MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWV LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHD LMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVIS NDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERP SLYTKVVHYRKWIKDTIVANP
UniProt accession: P07288

Data

Formalin-fixed, paraffin-embedded human prostate stained with anti-PAS antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of glandular cells.

FAQ & Publications

Frequently Asked Questions

What species is the rabbit anti-PSA monoclonal antibody (ZR232) reactive with?

This antibody is reactive with human species.

For which application is the rabbit anti-PSA monoclonal antibody (ZR232) specifically recommended?

It is suitable for Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for this antibody to ensure stability?

Store at 2-8°C for short term and at -20°C for long term storage. Avoid freeze/thaw cycles.

What is the host and clonality of the anti-PSA monoclonal antibody ZR232?

The antibody is produced in rabbit and is monoclonal in clonality.

What controls and visualization methods are recommended when using this antibody in IHC?

Prostate tissue is recommended as a positive control, and cytoplasmic staining is visualized using peroxidase-conjugated secondary antibodies with DAB chromogen.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.