Immunohistochemistry (IHC) : Human seminoma stained with anti-OCT-4 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of tumor cells.

rabbit anti-OCT-4 monoclonal antibody (ZR364) 6299

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to OCT-4
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Seminoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6299parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, monoclonal, OCT-4, Urinary Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-OCT-4 monoclonal antibody ZR364 6299

antibody
Database link: human Q01860
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Seminoma
Immunogen Recombinant fragment of human OCT-4/POU5F1 protein (exact sequence is proprietary)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens POU5F1 POU domain, class 5, transcription factor 1
Protein names POU domain, class 5, transcription factor 1
Alternative names Octamer-binding protein 3, Octamer-binding protein 4, Octamer-binding transcription factor 3
Gene names POU5F1
Protein family Belongs to the POU transcription factor family. Class-5 subfamily
Function Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 or SOX15 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency
Subcellular location Cytoplasm, Nucleus
Structure Interacts with PKM (PubMed:18191611). Interacts with WWP2 (PubMed:19274063). Interacts with UBE2I and ZSCAN10 (By similarity). Interacts with PCGF1 (PubMed:26687479). Interacts with ESRRB; recruits ESRRB near the POU5F1-SOX2 element in the NANOG proximal promoter; the interaction is DNA independent (By similarity). Interacts with ZNF322 (By similarity). Interacts with MAPK8 and MAPK9; the interaction allows MAPK8 and MAPK9 to phosphorylate POU5F1 on Ser-355 (By similarity). Interacts (when phosphorylated on Ser-355) with FBXW8 (By similarity). Interacts with FBXW4 (By similarity). Interacts with SOX2 and SOX15; binds synergistically with either SOX2 or SOX15 to DNA (By similarity). Interacts with DDX56 (By similarity). Interacts with ZNF143; promoting POU5F1/OCT4 association with promoters (By similarity)
Post-translational modification Sumoylation enhances the protein stability, DNA binding and transactivation activity. Sumoylation is required for enhanced YES1 expression Ubiquitinated; undergoes 'Lys-63'-linked polyubiquitination by WWP2 leading to proteasomal degradation ERK1/2-mediated phosphorylation at Ser-111 promotes nuclear exclusion and proteasomal degradation. Phosphorylation at Thr-235 and Ser-236 decrease DNA-binding and alters ability to activate transcription
Keywords 3D-structure, Alternative splicing, Cytoplasm, Developmental protein, DNA-binding, Homeobox, Isopeptide bond, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Transcription, Transcription regulation, Ubl conjugation
Sequence MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGI PPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPG AVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFS QTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENR VRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEA AGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
UniProt accession: Q01860

Data

Human seminoma stained with anti-OCT-4 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-OCT-4 monoclonal antibody (ZR364) specifically react with?

This antibody is reactive with human tissues.

What applications is the rabbit anti-OCT-4 monoclonal antibody (ZR364) recommended for?

It is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the rabbit anti-OCT-4 monoclonal antibody (ZR364) be stored to maintain stability?

Store the antibody at 2-8°C for short term use and at -20°C for long term storage, avoiding repeated freeze/thaw cycles.

What is the recommended dilution range for using the concentrated form of this antibody in IHC?

The recommended dilution for the concentrated antibody is between 1:100 and 1:200 for immunohistochemistry.

What is the host species and clonality of the anti-OCT-4 monoclonal antibody (ZR364)?

The antibody is a rabbit monoclonal antibody with an IgG isotype.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.